KEGG   Geobacillus thermodenitrificans: GTNG_3005Help
Entry
GTNG_3005         CDS       T00496                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GTNG_3005 (tpiA)
   01230 Biosynthesis of amino acids
    GTNG_3005 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTNG_3005 (tpiA)
   00051 Fructose and mannose metabolism
    GTNG_3005 (tpiA)
   00562 Inositol phosphate metabolism
    GTNG_3005 (tpiA)
Enzymes [BR:gtn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GTNG_3005 (tpiA)
Exosome [BR:gtn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GTNG_3005 (tpiA)
  Exosomal proteins of bladder cancer cells
   GTNG_3005 (tpiA)
  Exosomal proteins of melanoma cells
   GTNG_3005 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3102495..3103256)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMHKTLTEAVQFVEEVKGLVPPKAEVDSVICAPFLFLDRLVQNTNGTDLQ
IGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRG
LVPIICCGETLEEREAGQTNAVVASQVEKALAGLTPDQVKQAVIAYEPIWAIGTGKSSTA
EDANNVCGHIRSVVARLFGAEAAEAIRIQYGGSVKPENISDFLAQEHIDGALVGGASLEP
ASFLKLVEAGRHE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccgatcattgcaggcaactggaaaatgcataaaacattgacggaagctgtt
cagtttgtcgaggaagtcaaagggcttgtacctccgaaagcggaagttgattccgtcatt
tgtgcaccatttttgtttttagatcggttggtgcaaaatacaaacggcaccgatttacaa
atcggggcgcaaacgatgcattttgccgaccaaggagcatataccggtgaagtgagcccg
gtgatgctcaaagaccttggtgtgacgtatgtcattctcggccattccgagcgtcggcaa
atgtttgccgaaacggatgaaacggtcaataagaaagtgttggccgccttcacccgtggt
ctcgtgccaatcatttgttgcggcgagacgctcgaagaacgggaagcagggcagacgaat
gcggttgtcgcttcacaagtggaaaaagcgctcgctggattgacgccagatcaagtgaag
caagcggttatcgcttacgagccgatttgggcgatcggcactggcaaatcgtcgaccgct
gaagatgccaacaacgtctgcggccatatccgttctgtcgtcgcacgtctgtttggcgcg
gaagcggcggaggccatccgcatccaatacggtggcagcgtcaaaccggaaaatatcagc
gactttttagcacaagaacacatcgatggagcgttagttggtggcgcgagccttgaaccg
gcttcgttcttgaagcttgtggaggcgggacgccatgagtaa

DBGET integrated database retrieval system