KEGG   Geobacillus thermodenitrificans: GTNG_3005Help
Entry
GTNG_3005         CDS       T00496                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00010  Glycolysis / Gluconeogenesis
gtn00051  Fructose and mannose metabolism
gtn00562  Inositol phosphate metabolism
gtn01100  Metabolic pathways
gtn01110  Biosynthesis of secondary metabolites
gtn01120  Microbial metabolism in diverse environments
gtn01130  Biosynthesis of antibiotics
gtn01200  Carbon metabolism
gtn01230  Biosynthesis of amino acids
Module
gtn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gtn_M00002  Glycolysis, core module involving three-carbon compounds
gtn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTNG_3005 (tpiA)
   00051 Fructose and mannose metabolism
    GTNG_3005 (tpiA)
   00562 Inositol phosphate metabolism
    GTNG_3005 (tpiA)
Enzymes [BR:gtn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GTNG_3005 (tpiA)
Exosome [BR:gtn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GTNG_3005 (tpiA)
  Exosomal proteins of bladder cancer cells
   GTNG_3005 (tpiA)
  Exosomal proteins of melanoma cells
   GTNG_3005 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABO68350
UniProt: A4ISP6
Position
complement(3102495..3103256)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMHKTLTEAVQFVEEVKGLVPPKAEVDSVICAPFLFLDRLVQNTNGTDLQ
IGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRG
LVPIICCGETLEEREAGQTNAVVASQVEKALAGLTPDQVKQAVIAYEPIWAIGTGKSSTA
EDANNVCGHIRSVVARLFGAEAAEAIRIQYGGSVKPENISDFLAQEHIDGALVGGASLEP
ASFLKLVEAGRHE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccgatcattgcaggcaactggaaaatgcataaaacattgacggaagctgtt
cagtttgtcgaggaagtcaaagggcttgtacctccgaaagcggaagttgattccgtcatt
tgtgcaccatttttgtttttagatcggttggtgcaaaatacaaacggcaccgatttacaa
atcggggcgcaaacgatgcattttgccgaccaaggagcatataccggtgaagtgagcccg
gtgatgctcaaagaccttggtgtgacgtatgtcattctcggccattccgagcgtcggcaa
atgtttgccgaaacggatgaaacggtcaataagaaagtgttggccgccttcacccgtggt
ctcgtgccaatcatttgttgcggcgagacgctcgaagaacgggaagcagggcagacgaat
gcggttgtcgcttcacaagtggaaaaagcgctcgctggattgacgccagatcaagtgaag
caagcggttatcgcttacgagccgatttgggcgatcggcactggcaaatcgtcgaccgct
gaagatgccaacaacgtctgcggccatatccgttctgtcgtcgcacgtctgtttggcgcg
gaagcggcggaggccatccgcatccaatacggtggcagcgtcaaaccggaaaatatcagc
gactttttagcacaagaacacatcgatggagcgttagttggtggcgcgagccttgaaccg
gcttcgttcttgaagcttgtggaggcgggacgccatgagtaa

DBGET integrated database retrieval system