KEGG   Geobacillus thermodenitrificans: GTNG_3152Help
Entry
GTNG_3152         CDS       T00496                                 

Gene name
nbaJ
Definition
(GenBank) Acylating acetaldehyde dehydrogenase
  KO
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GTNG_3152 (nbaJ)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GTNG_3152 (nbaJ)
   00650 Butanoate metabolism
    GTNG_3152 (nbaJ)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    GTNG_3152 (nbaJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GTNG_3152 (nbaJ)
   00622 Xylene degradation
    GTNG_3152 (nbaJ)
   00621 Dioxin degradation
    GTNG_3152 (nbaJ)
Enzymes [BR:gtn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     GTNG_3152 (nbaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3253918..3254751)
Genome map
AA seq 277 aa AA seqDB search
MIKLERSSHLELTAMIGIDPESDGLKKAKTKGYYVFDGGLKQFLSEASELADLVFDATSA
KAHVRHAKALREAGKMVIDLTPAAVGPYVVPSVNLGDYLEESNLNLITCGGQATIPIVHA
INRVAQVHYSEIVATIASKSAGPGTRANIDEFTQTTAHGLEAIGGAKKGKAIIILNPAEP
PIIMRNAVYALVECEQMDEVAIARSVQETVAYIQSYVPGYRLRTEPLFEGNKVTVFVEVE
GAGDYLPTYSGNLDIMTATAIKVAEEWVQHRVKAASV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctggagaggtcgtcgcatctggagttgactgcgatgattggcatcgacccc
gaatcagacgggctgaaaaaggcaaaaacgaagggatattacgtgttcgacggagggttg
aaacagtttctcagtgaggcctcagagctggccgaccttgtatttgacgccacctccgcc
aaggcccacgttcgccatgccaaagctctgagagaggcggggaagatggtcatcgacctg
accccggcggcggtgggaccgtacgtggtgccgtccgtcaacctgggggattacttggaa
gaatccaacctcaacctaatcacctgcgggggtcaggcgacgattccgatcgtgcacgcg
atcaaccgggtggcgcaggttcactattcggagattgtggccaccattgcaagtaagagc
gccggaccaggcacccgggctaacatcgacgagttcactcagacgacagctcatggcttg
gaggcaattggcggcgcgaaaaaaggaaaggcgatcatcattctcaatccagccgaaccg
ccgattattatgcgaaacgcggtgtacgccctggtggagtgtgaacagatggacgaggta
gccatcgcccggtcggttcaggagactgttgcttacatccagtcctatgtacctgggtac
cgtctgcgcactgagccgctatttgaaggcaacaaggttacggtgttcgtagaggtggag
ggggctggcgactatctcccgacgtattctggcaacctggacatcatgacggccactgcc
atcaaggtggcggaggaatgggttcaacaccgtgtgaaagctgcttcggtttga

DBGET integrated database retrieval system