KEGG   Geobacillus thermodenitrificans: GTNG_3215Help
Entry
GTNG_3215         CDS       T00496                                 

Definition
sucrose phosphorylase-like protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GTNG_3215
Enzymes [BR:gtn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     GTNG_3215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3321108..3322805)
Genome map
AA seq 565 aa AA seqDB search
MRKQTILPQLEEKLKTIYGEQYNDEYLMAFQALIERWENKQWPTSAPLSEENVYLITYGD
SIFEDGTPTLETLHTFLKTQVGDWITDVHLLPMFPYTSDDGFSVVDYRRIHPRLGDWEHI
EQLAEDYRLMFDFVANHISKSSDWFQKYLQGDPTYERYFIQRDPSFDTSQVIRPRTTPLF
HDYPGTNNTKTVWTTFSEDQIDLNYRHFPVLLEMTDILLEYAYKHGTSIRLDAIGFIWKE
SGTTCMHLPQAHAIIQLWRLLLDYFKPNTQIITETNVPHHENISYFGDGTNEAHMVYQFA
LPPLVLYTFTVHCATKLTEWAKTIEKISDQATYFNFLASHDGIGMRPVEGILSEQEKEML
VQKVLQNGGRVSYKANTDGSQSVYELNITYFDALINKDVDVTEQQQIQKMLAAHSILFSM
MGVPALYYHSLLGSRNDYHGLAESGIHRRINREKLPYARIVDELANNERRNAIFNGLKQM
VEIRRQQSAFSPYAPQTVLELDDRVFGLKRENEKTKEVVYCVVNVTPDDVTIETDISGED
LFTGKKVHKSLALSPYQYVWVKADR
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaacaaactatattgccgcagctagaggaaaagctgaaaaccatatatggcgag
caatacaatgacgagtatttgatggcttttcaagcgctcattgagcgatgggagaacaaa
caatggccaaccagtgccccgctctccgaagaaaatgtatatttgatcacgtacggagac
agtattttcgaagacggaacgccaacgctagaaacattgcatacatttttaaagacacaa
gtcggggactggattacagatgtccatttactccccatgtttccatatacgtcagatgat
ggtttttctgtggtcgattaccgtcgcattcatccgcggcttggcgactgggagcacatt
gaacaattggcggaagactatagattgatgtttgactttgtagccaaccacatttcgaag
tcaagcgattggtttcaaaagtatttgcaaggcgatccaacttatgaacggtattttatt
cagagggatccatcatttgatacaagtcaggtcatccgcccgcgtactacaccgctgttt
cacgactatccaggaacgaacaatacaaagacggtgtggacaacgtttagcgaagaccaa
attgatctcaattatcgccattttcctgttttgcttgagatgactgatattttgctagag
tatgcatataaacacgggacaagcattcgcttagacgcgatcggttttatatggaaggaa
tcagggacgacttgcatgcatttaccgcaggctcatgccatcattcagttgtggcgtctg
cttctcgattatttcaaaccaaatacgcaaatcattaccgaaacaaacgtgccacatcat
gaaaacattagctattttggagatgggacaaacgaggcccatatggtgtatcagttcgcc
cttccaccgcttgtgttatacacgtttaccgttcattgtgcgacaaaattaacggagtgg
gcgaagacgattgaaaaaatatctgatcaagcgacgtactttaatttcttggcaagccat
gatggcattggaatgcgtcccgttgaggggattttaagtgaacaagagaaggagatgctt
gtccaaaaagtgttgcaaaacgggggaagggtctcctataaagcaaacacggacgggagt
cagtcggtgtacgagttaaatattacgtactttgatgccttaatcaataaggacgtggat
gtgaccgaacagcagcaaattcaaaaaatgttagctgcgcattccattttattctcgatg
atgggggttccggctctgtattatcactcgttgcttggttctcgcaacgattaccacggc
cttgccgagtcaggcattcaccgtcggatcaaccgcgaaaaacttccgtatgcccgaatt
gtcgacgaattggccaacaatgagcggcgaaacgccatctttaacgggctgaaacaaatg
gtcgagattcgccgccaacaatcagcgttttctccatacgcgccgcaaaccgttcttgaa
ttggatgatcgtgtatttgggctaaaacgggagaatgagaagacgaaggaagtcgtgtat
tgtgtcgtcaatgtgacccccgacgatgtcaccatcgagacagatatcagcggggaggat
ttgttcacagggaaaaaagtgcacaagtctctcgctttgtcgccataccaatacgtatgg
gtcaaggcggatcgatga

DBGET integrated database retrieval system