KEGG   Geobacillus thermodenitrificans: GTNG_3329Help
Entry
GTNG_3329         CDS       T00496                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gtn00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:gtn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3434668..3435954)
Genome map
AA seq 428 aa AA seqDB search
MDKIKIIGGDRLQGTIKVSGAKNSAVALIPAAILADSPVTIEGLPDISDVRILGSLIEEI
GGSFWFDGKKAIIDPTNMVSMPLPNGKVKKLRASYYLMGAMLGRFKKAVVGLPGGCHLGP
RPIDQHIKGFEALGATVTNEQGAIYLRAEELRGARIFLDVVSVGATINIMLAAVRAKGRT
IIENAAKEPEIIDVATLLSNMGAKIKGAGTDVIRIDGVEKLSGCRHAIIPDRIEAGTYMI
AAAATGNEVVIDNVIPQHVESLTAKLREMGVHVETGADQIWICGSDVLKAVDVKTLVYPG
FPTDLQQPLTALLTKADGTSVVTDTIYSARFKHIDELRRMNANVKVEGRSAIITGPVNLQ
GAKVKASDLRAGAALVIAGLMAEGVTEITGVEHIDRGYSGLVEKLSKIGATIWREKMTDE
EIEQVKNA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggataaaataaaaattatcggcggggatcggctgcaggggacgattaaagtgagcggc
gcgaaaaacagcgctgtcgccttgattcctgcggcgattttagccgattcgccggtgacg
atcgaagggttgccggacatttccgacgtgcgcattttgggaagcttgatcgaagagatc
ggcggttcgttttggtttgacggcaaaaaggcgatcatcgatccgacgaacatggtttct
atgccgcttccaaacggaaaagtaaaaaaactgcgcgcttcgtactatttgatgggagcg
atgcttggccggttcaaaaaagcggtcgtcggcctgccgggcggctgtcatctcggaccg
cgcccgatcgaccagcacattaaaggatttgaggcgctcggtgcaacggtaacgaacgag
cagggcgccatttacttgcgcgctgaggagctccgcggggcccgcatttttttggacgtc
gtcagcgtcggtgcgacgatcaacattatgctggcggcggtgcgcgccaaagggcggacg
attatcgaaaacgccgcgaaagagccggaaatcattgatgtggcaacattgctttcgaat
atgggcgcaaaaattaaaggcgcgggcaccgatgtcatccgtatcgacggcgtcgaaaaa
ttatcgggctgccgccatgccatcatcccagatcggattgaagccggtacgtatatgatt
gccgccgcagcgaccggcaacgaagttgtcattgacaacgttattccgcagcacgtcgaa
tcactgacggcgaaattgcgcgagatgggcgtgcacgtcgagacgggtgcggatcaaatt
tggatctgcggctccgatgttttgaaagcggttgacgtcaaaacgctcgtctacccgggg
ttcccgaccgatttgcagcagccgttaaccgccttgttgacgaaagcagacggcacgagt
gtcgtcacggatacgatttacagcgcacgcttcaaacatatcgatgaattgcggcgcatg
aacgcgaacgtgaaagtcgaaggtcgctcggccattatcactggtccggtcaatttgcaa
ggcgcaaaagtaaaagcgagcgacttgcgcgctggggcggcgctcgttatcgccgggctc
atggcagaaggagtgaccgaaatcactggcgttgagcatatcgatcgtggctacagtggg
ttagtggaaaagctgtctaagatcggcgccaccatttggcgtgaaaaaatgaccgatgaa
gaaattgaacaagtaaaaaatgcgtaa

DBGET integrated database retrieval system