KEGG   Gloeophyllum trabeum: GLOTRDRAFT_120322Help
Entry
GLOTRDRAFT_120322 CDS       T03130                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
gtr  Gloeophyllum trabeum
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    GLOTRDRAFT_120322
   00500 Starch and sucrose metabolism
    GLOTRDRAFT_120322
Enzymes [BR:gtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     GLOTRDRAFT_120322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 538 aa AA seqDB search
MWPLTLPLAIGLAALAQASVFAADAEPIPGNYSGQLRPQIHFSPPKEFMNDPNGMFLDAE
GTYHLYYQYNPTNLVGGNQTWGHATSKDLFHWINQPIAIHPPNNNSQVYSGSAVIDVNNT
SGFFPNQTNGVVAIYTLNSPNLEVQEIAYSLDGGYTFERYEGNPVLDVHSSQFRDPKVLW
HAETGKWVMVVAYATDLVIGIYTSPNLKDWTHASNFSRANALGSQYECPNLVALPLINVD
GSSSTAYILQISINPGAPLGGSITTYFPGSFNGTHFTPSDSEIRFTDFAKDNYAGQFFYG
LPADEKQLSIIWANNWQYAESVPTDEEGWRSAMSLAKANSLRDTGDAGYQLVQELVDLRP
VYNSTLANVSTSDNLSTSVDYSSVTSGAVYLDVNITNIVTPAGSLNLTFTSTSGGSLSAG
YLLSSGEFWINRGNIHEFANFSNDGFTETFNTTYCVEGSVWRLQAVVDRTLLEVFIDRGK
STATMVFYPADKLDGLTVSAEGLGQDVGVSATVWGLKSAWAEEADASGIVLGNVTSTT
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtggcctctcactcttcccttagccatcggcctggccgcactcgcgcaagcatcagta
tttgctgctgatgctgaaccaattccgggaaactacagtggccaactgcgcccccagatc
catttttcccctcccaaagagtttatgaacgacccgaacgggatgttccttgacgcggag
ggtacctaccatctatactaccagtacaatcccacgaacctcgtcggaggaaaccagacg
tgggggcatgcaacttcgaaagacctcttccactggataaaccagccaatcgcgattcac
ccgccaaataacaactctcaggtatactccggatctgcggtgatcgacgtcaacaacacc
tctgggttcttcccgaaccagaccaacggcgtcgtggcgatctatacgttgaacagcccg
aacctggaagtacaagagatcgcttactcgcttgacggcgggtacacctttgagcggtac
gaagggaacccggttctagacgtgcactcttcccagtttcgcgacccgaaagtgctctgg
cacgcggagacggggaaatgggttatggtcgtcgcatatgctacagatctcgtgatcggg
atatatacttctcctaaccttaaggactggacacacgcctccaacttctcgcgcgcgaat
gcgctcggctcgcaatacgaatgtcccaatctcgtcgccctgccgctaatcaacgtggat
ggcagttcatctacagcgtacatcctccagatatccatcaaccccggtgcgccgctcggc
gggtcgatcacgacgtacttccctggatcgttcaacgggacccacttcaccccctctgac
tccgagattcggttcactgattttgcgaaggacaactacgcaggccaatttttttacggg
ttgcccgctgacgagaagcagctcagcatcatctgggcgaataactggcagtacgcggag
agcgtcccgaccgacgaggagggatggcggagcgcgatgagtcttgcgaaggcaaactca
ctgagagataccggtgatgcggggtatcagcttgtgcaggagcttgtcgacctgagacct
gtctacaactcaacacttgctaacgtctcgacttccgataatctcagcacatcggttgac
tattcgagcgtcacctcaggcgctgtatatctcgacgtcaatatcacgaatatcgtgaca
cccgcagggtccctgaaccttaccttcacttcaaccagtggaggatcgctatccgcaggg
tacctgctctcctcaggtgaattctggatcaaccggggaaacattcacgagttcgccaat
ttcagcaatgatggttttaccgagacgttcaacacaacgtattgcgtggaaggcagcgtg
tggcggttacaggccgtggtagaccgtacgttgctggaggtcttcattgacagggggaag
agcactgccacaatggtgttctatcctgcagacaagttggacggactcaccgtgtcggcc
gagggcttgggacaagacgtgggcgtaagtgccaccgtctggggcctaaaaagtgcctgg
gctgaggaggcggatgccagtggcatcgtgttggggaacgtcacgagcacgacgtga

DBGET integrated database retrieval system