KEGG   Guillardia theta: GUITHDRAFT_103131Help
Entry
GUITHDRAFT_103131 CDS       T02925                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
gtt  Guillardia theta
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GUITHDRAFT_103131
Enzymes [BR:gtt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     GUITHDRAFT_103131
Exosome [BR:gtt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GUITHDRAFT_103131
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 470 aa AA seqDB search
MGLVAVVVLVIFFSAVGKEDKSKMKPVMCAGGNGTLRRISREAYDYWSRVNPKAERSLVI
MLGDGYGPDVHSMSRSVMRKMLGNESYRLPLDDFLVGTSITSALGNVITDSAAGATAYAN
GVKTVNGAIGVEPADLSEHGVRKCADSLGGTKKTPDCPVADQTSCCPLKRIANAFEGCRA
KGMATGLVVLFAQAARQNKVVFQSFLLNSVKEEAKSRSSSETGDSVVKREMTEAALTRLK
ATGKKFCLMVEGSRIDHALHGNDAAGAAFDTFAYNDAFEAVNRFIEAERTSGHEIEVISV
ADHSCGGITTGMQTNWQPKFSQPICLPGGSCQVQIGTSAYGTTDGWTPEVLARARISLPQ
LSAQVCCNQTLRKSFPSVLARIQDELGISPSSEDQANFQQAASRVAFTTASHTSVDINVY
ASWDIQDRFRGSNENDEIGRRIIREVLELDSSVMDPISQALEECQVPVVP
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgggattggtggctgttgttgtcctggtgatcttcttcagcgccgttggcaaggaggac
aagtcgaagatgaagcctgtcatgtgcgcgggagggaacgggacgctgcggaggatctcg
agggaggcctacgactactggtcgagagtcaaccccaaggctgagaggagccttgtgatc
atgcttggagatggatacgggcccgacgtccactcgatgagcaggtcggtgatgaggaag
atgctgggcaacgagagctacaggctgcctcttgacgacttcctcgtcggcacctccatc
acctccgccctcggcaacgtcatcaccgactcggcggcaggggcgacggcgtacgccaac
ggcgtgaagacggtgaacggagccatcggggtagaaccagcggatctgtctgagcatggc
gttcgcaagtgcgctgactctctgggagggacgaagaagactccagactgtccggtggcc
gatcagacgtcatgctgcccactgaagaggatcgccaacgccttcgagggatgcagggca
aagggcatggccaccggccttgttgtgttgttcgctcaggcagctcgacagaacaaggtc
gtctttcagagtttccttctcaactccgtcaaggaagaggccaaatcacgttcctcctct
gaaactggggacagtgttgtcaagagggagatgacggaggctgcgctgacgagactcaag
gcaacgggcaagaagttctgcctcatggtcgagggatcgcgtatcgatcacgcgctgcac
ggcaacgacgcggctggagctgcctttgacacttttgcctacaacgacgccttcgaggct
gtgaaccgtttcatcgaggcagaacgcaccagcgggcacgagatcgaggtcatttctgtc
gccgatcacagctgcggcggcatcaccacgggcatgcagacgaactggcagccgaagttt
tcgcagcccatctgcctgccaggaggctcctgccaagttcagatcgggacgtcagcatat
ggcaccaccgatggatggacgccggaggtccttgctcgtgctcgcatctccctcccgcag
ctctcggcgcaggtctgctgcaaccaaaccctcaggaagtctttcccctccgtcctagca
agaatccaggacgagctgggcatctcccccagctcagaggaccaggcgaacttccagcaa
gcggcatcccgagttgccttcacaacagcgtcgcacacctcggtggacatcaacgtctac
gcgtcttgggacatccaagatcgcttccgagggtccaacgagaacgacgaaataggaagg
aggataatccgggaggtgctggagctggactctagtgtgatggatcccatctcacaggca
ctcgaggagtgtcaagtccccgtcgtgccctag

DBGET integrated database retrieval system