KEGG   Guillardia theta: GUITHDRAFT_103164Help
Entry
GUITHDRAFT_103164 CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
gtt  Guillardia theta
Pathway
gtt00220  Arginine biosynthesis
gtt00250  Alanine, aspartate and glutamate metabolism
gtt01100  Metabolic pathways
gtt01200  Carbon metabolism
gtt01210  2-Oxocarboxylic acid metabolism
gtt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gtt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GUITHDRAFT_103164
   00220 Arginine biosynthesis
    GUITHDRAFT_103164
Enzymes [BR:gtt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     GUITHDRAFT_103164
Amino acid related enzymes [BR:gtt01007]
 Aminotransferase (transaminase)
  Class I
   GUITHDRAFT_103164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 17308041
NCBI-ProteinID: XP_005838227
JGI: Guith1_103164
UniProt: L1JS25
Position
Unknown
AA seq 483 aa AA seqDB search
MKPHVLQRRGIQLTAETINPKVLDAQYAIRGALVLRAMQHERNLKESVRMPFDEIIYCNI
GNPQQLNQKPITFFRQVLALMDYPDLVEMPKAKKLFPEDAIERARMFFSNIPGGTGAYSE
SQGIRLVREHVAEYISKRDNLVASADDIFLTDGVSQGVNMSMNVLIRNEKDGILIPIPQY
PLYTATISLNGGRAVGYFLKEEKGWSMDLGELDRAYQEAKNQGTNIRAMVVINPGNPTGQ
CLTEANIREVVKFCEHNNLVILADEVYQTPIYGETPFTSFRKVVTDMGSSVELISYHSVS
KGMIGECGRRGGYMELRNIDTVVREQIYKLVSIGLCSNIAGQMMVDLMVKPPQEGEPSFA
LYQEEMNNLQESLTRRAHKLSTALNAMDNISCNAIEGALYAFPKIDIPYKAVQAAKDSGM
TPDTFYCVELLDATGICVVPGSGFRQKKGSFHFRTTFLPSEEKMDIVIEKLQKFNKTFDT
IYR
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaagccccacgtgctccagcgccgaggcatccagctgactgcagagacgatcaatccc
aaggtcctcgatgctcagtacgccatccgaggagctctcgtcctacgtgctatgcagcac
gagaggaatctcaaggagagtgtcaggatgccgttcgacgagatcatctactgcaacatc
ggcaacccgcagcagctgaaccagaagccgatcacattcttccgacaggtgctggcgctg
atggactatcctgacttggtcgaaatgccaaaagcgaagaaattgtttcctgaggacgcg
attgagcgagcaaggatgttcttcagcaacatcccaggagggacgggagcgtatagtgaa
agtcagggcatccggctggtcagagagcacgtggcagagtacatctcaaagagggacaat
cttgttgcttctgcggacgacatcttcctcacggacggcgtgagtcagggagtgaacatg
tccatgaacgttctcatcaggaacgagaaggacgggatccttattcccatcccacagtat
cctctctataccgcaacgatctccctgaacggagggcgggccgtgggctacttcctcaag
gaggagaagggttggagcatggacctcggtgaactcgatcgtgcgtatcaggaggcgaag
aatcagggaaccaacattcgagcaatggtggtgatcaacccggggaacccgacgggacag
tgtctgacagaggcgaacataagggaggttgtaaagttctgtgagcataacaatcttgtc
atcctggcggacgaggtgtaccagacgcccatctacggcgagaccccgttcacctccttc
aggaaggtcgtgacggacatgggcagctccgttgaactcatctcctaccactccgtgtcc
aaggggatgatcggggagtgcgggaggaggggagggtacatggagctccgcaacattgac
acggtcgtgcgggagcagatctacaagcttgtctccatcggcctctgctccaacatcgcg
ggccagatgatggttgacctgatggtgaagcccccgcaggagggggagccgagctttgcg
ctctatcaggaggagatgaacaatctgcaggagtcgctcacccgcagggcacacaagttg
tcgaccgcgctcaacgccatggacaacatctcctgcaacgccatcgagggagccctctac
gcctttcccaagatcgacatcccctacaaggctgtgcaggcagccaaggactccggcatg
acgcctgacaccttctactgcgttgaactgctcgatgccactggtatctgtgtggtcccg
gggtcaggattcaggcagaagaagggtagctttcatttccgcaccaccttcttgccgagc
gaggagaagatggacattgtcatcgagaagttgcagaagttcaacaagacctttgacacc
atctacagatag

DBGET integrated database retrieval system