KEGG   Guillardia theta: GUITHDRAFT_105053Help
Entry
GUITHDRAFT_105053 CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
Organism
gtt  Guillardia theta
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 17305664
NCBI-ProteinID: XP_005835950
JGI: Guith1_105053
UniProt: L1JLI1
Position
Unknown
AA seq 696 aa AA seqDB search
MNLGLKRKSSILATLFANELQGESQAVLLSKEIFRLNIDSVDLWAPCSASLLPRSISLLD
KESMNQVHVPLDIICGIEQVGGRAETKNLTLIRIQESEVHTKYVTYWILVLSTKMESAFN
GRSVHLRFEEEDEATRWNQEITKLIKHRLASEHIAREGRLRIFRDLSRRAYYSRPFQSVF
ALLIGMNFLINMIEAEIRPADNSAQKFTFDRFDMFFTSLFAFEFVWNFSSNVSKKFFEDG
WNWFDFFVVVMSISSFIVSGVPILTVFRLLRVFKALRLFRQFKSLRIIFNSLLASVFPII
NSVFILLVVTAIFAILAVQLYGYRSDQFSNFQQAIFSLYQVATGDAWASGIARPLFYKLD
SKPDPSVMPFFTAYSILSSRILINVVVAVLLDNFIRCVKVEEWKELQAELEKERQGIEVS
SRVLDPLMKYLSKHDTEEHFQAQVQKVFSIVNFKLKESVNFDDVHKGLKALGLKPMIELR
KDDFDYITAEGRYCNELGEISAENFSKMISRQYKMFCARKLCDLQKITDGADMVVHLATK
MVLVMEDPDWKSDDLFRWKSKGRKKEEEEEEEEEEESVSNRHYPESLHDLPKSVLIENLE
RIKQERNEYKFQLDCMERRMKLQGPPLSLADKFEMLAPRQDASPPHVNRFVPSIFPSGLL
PLDGSSWRRQGGAAGGEEGQARKVRGHWGADSLFVA
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttggcctcaagagaaagtccagcattcttgctactttgttcgcaaatgaattg
cagggtgaatcgcaagcagtcctcctcagcaaggaaatctttcgactgaacatcgacagt
gttgacttgtgggcgccatgctcggccagtctgttgccgcgttctatctcgttgctggac
aaggagagcatgaatcaagtgcatgtccccctggacatcatctgcggcattgaacaagtc
ggagggagggcggaaaccaaaaacttgaccctgatcaggatccaagagtcggaggtccac
accaagtatgttacctactggatcttggtgctttcaacgaagatggagtcagcgttcaac
gggaggagcgtgcacttgaggttcgaggaggaggacgaggcgacacgatggaatcaggag
atcacaaagttgatcaagcatcgcctagccagcgagcacatcgcaagggaaggcaggcta
aggatattcagggacctgagtcgaagggcatactacagccgacccttccagtcggtcttt
gcgctactgatcggcatgaacttcttgatcaacatgatagaggctgaaattcggccggcg
gacaactctgcccagaagttcactttcgaccgtttcgacatgttcttcacctccctcttc
gccttcgagtttgtttggaacttctcgtccaatgtgtcaaaaaaattcttcgaggacggt
tggaactggtttgacttctttgttgtcgtcatgtcaatatcttcattcatcgtctcggga
gtcccgatcctcactgtctttcggctgcttcgagtattcaaggctctgcggctcttccgg
cagttcaaatccctcagaatcatcttcaactctctcctcgcaagtgtcttccccatcatc
aactcagtcttcatcctactcgtcgttaccgccatcttcgccatcctcgctgtccagctg
tacggctaccgctcggatcagttttcaaacttccagcaggcaatcttctcgctctaccag
gtggcaactggcgacgcttgggcgtcgggaatcgctcgtcctctcttctacaagcttgac
tcgaagcctgatccctcggtcatgccgttcttcaccgcctactccatcctctcgtcgcgg
atcctcatcaacgtcgttgtggccgtcctgctcgacaacttcatcagatgcgtcaaggtc
gaggagtggaaggagctgcaagcggagctggagaaggagcggcaagggatcgaggtgtct
tcgagggtgctggaccctctcatgaagtacctgtccaagcacgacacggaagagcacttc
caggcgcaggtgcagaaagttttcagcatcgtcaacttcaagctcaaggagagcgtcaac
ttcgacgacgtgcacaaggggctgaaggcgctggggctgaagccgatgatcgagctgaga
aaagatgactttgactacatcacagctgaagggagatactgtaacgagctgggggagatc
tcagctgagaacttctcgaagatgatcagcaggcagtacaagatgttctgcgcgaggaag
ctctgcgatcttcagaaaatcaccgacggggcggacatggttgtccatctggcaaccaag
atggtgctggtgatggaggaccctgactggaaaagcgacgatctcttcagatggaagtcg
aaggggagaaagaaggaggaggaggaggaggaggaggaggaggaggaatcagtttcaaat
cgtcactaccctgagagtctccatgatctgcccaagagcgtcctgatcgagaatcttgag
aggatcaagcaagagaggaacgagtacaagttccagctggactgcatggagaggaggatg
aagctgcaaggccctcctctatccctggccgacaagtttgagatgctggctcctcgacag
gacgcgtcgcctccccacgtcaaccgcttcgttccatccatcttccctagtgggctgcta
cccttggacggctcctcctggaggcgccaaggaggagctgctgggggcgaggagggtcag
gcaagaaaagtgagggggcactggggtgctgatagtctatttgtcgcataa

DBGET integrated database retrieval system