KEGG   Guillardia theta: GUITHDRAFT_105170Help
Entry
GUITHDRAFT_105170 CDS       T02925                                 

Definition
hypothetical protein
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gtt  Guillardia theta
Pathway
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:gtt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GUITHDRAFT_105170
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GUITHDRAFT_105170
Enzymes [BR:gtt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GUITHDRAFT_105170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 964 aa AA seqDB search
MPLGLQHGRANSFADKDYLILSSDVKFLRTLFFQALRAEEADETVYRKANKELKDNLEGI
PGIPQSVKELFQISLMYEQDPTEKNFKAMHQKVLHMSAADIKIAGRLFLEMLQHANLVER
NHRVRRWREYKRGDKTVKSSSSQTLQDCFKELMEKGFTPEQIRESLLRQNTELVFTAHPT
QAARRSVLTKHATISQLLELHDRSGPNGTSKLTPLQRSEILAALQESLLGIWRTNPYGLS
VVEESLWEALPDHYHAVDYALKKIGCEPLPIDCCLLTLGSWMGGDRDGNPYVTAVLTKRV
VFLSQWRAAHLYWTEVDQLLWDLSVAGPGNKEIQEEIARINGIKSSNAKGTLKKNHSLTS
VHNLLAPFDFYRPQLETEENYRQVLTHIRARLAATVRRATALSQEQPFKPDPINHHYSST
SELATDLLRIYRSLHECGDGILAEGRLKELLWRVHTFGLSLTRLDIRQESTRHADALDEV
TSYLGLGSYRTWSEETKIQWLTNELHSKRPLIPPDLPCSAPVKEVIDTFKMIAEIGSEPF
GAYVISMTTSASDVLAVRLLQKEAGIQQHLRVVPLFETKLDLENAPACMELLFKNSWYQA
NLSSPPQVPNIGWQPHQEVMLGYSDSAKDAGRLASVWGLHKAQEALVELSHKYKIKLNLF
HGRGGSVGRGGGPQYLATLSQPAGSVQGWMRVTVQGEVIDHYFGLPSIASHTMERYTTSV
LTATLTPPKAPSDDFREIMQRLSETSCNKYRSLVFEDPEFIEYFRTATPDFELKGLNLGS
RPSKRKQGGIESLRAIPWMFAWTQTRLQLPVWLGVGTALKAEIDNGNLKTLQDMYNDWPF
FRSTVELLEMVLAKTSKTIADYYESLLVPEDLQSVSSKVWEEFENTMKSILQVIRHEHML
EGDSSLSSRLAIATRVPLVDPINVLQANALVRMRADENQPDIHVLRDAFAITVQGVAAGM
GWTG
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcggacttcaacatggaagagcgaattcgttcgcagacaaggactacctaatc
ttgtcctctgacgtcaagttcttgcgcacactgttctttcaggcgttgcgggctgaagag
gcagacgagacagtgtacaggaaggcgaacaaggagctgaaggataacctggagggcatc
cccggaatcccacagagcgtgaaggagctcttccagatcagtctcatgtacgagcaagat
ccgacagagaagaacttcaaggcgatgcatcagaaagttctgcacatgagtgctgcggac
ataaagattgctggccgactgttcctggagatgttgcagcatgccaatcttgttgagagg
aatcatcgagtgcgcaggtggagagagtacaagcgtggcgacaagactgtgaaatcctcc
tcttcccagactttgcaggattgcttcaaggagctcatggagaaaggcttcactcctgaa
cagatcagagagtctctgcttcgacagaacacagaacttgtgttcacagcccatcccact
caggctgctcgaagaagtgtcttgaccaagcatgcaacgatttctcaacttcttgagctc
catgaccgcagcgggccaaatggaacctcgaagctcacgccgctccagaggtctgagatt
cttgctgcgttgcaagagtcgttgctgggtatctggcgaaccaatccatatggtctttca
gttgtggaagaatccttgtgggaggctcttcccgaccattaccatgcagtcgattatgca
ttgaagaagatcggatgcgaaccacttcctattgactgttgcctcttgacgctggggtcc
tggatgggaggagatcgtgatggaaatccgtacgtcacagcggttctcaccaagagagtc
gttttcctctcccagtggagagcagcgcacttgtattggactgaggttgatcaactgttg
tgggatttgtctgtcgctggtcctggaaacaaggagattcaagaagagattgctaggatt
aatggtatcaagtcaagcaacgccaagggaacactcaaaaagaatcattcccttacctcc
gtgcacaacctactggccccttttgatttctatcgccctcagcttgagaccgaggaaaac
tacagacaggttctcacccacattcgtgcccgtcttgccgccacggtccgtcgcgctaca
gctctctcacaggagcagcctttcaagcctgatccaatcaatcatcactacagctcaact
tctgagcttgccacggatcttctccgtatctatcggtcccttcacgaatgtggtgatgga
atcttggcagagggacgcttgaaggagcttctttggcgtgtccacacttttggattgtca
ctcactcgcctggacattcgccaggaaagcacaaggcacgctgacgctctggatgaagtc
acaagctaccttgggttgggttcatacagaacctggagcgaggagacgaaaattcagtgg
ttgaccaacgagttgcactcaaagcgcccattgattcctcctgacctcccttgctcagct
cccgtcaaggaagtcatcgatacctttaagatgatagcagagattggctctgaacctttc
ggcgcttatgtgatatctatgactacgtctgctagtgacgttttggctgttcgattgctt
caaaaggaagctggcatccagcaacatctcagagtggttccgttgtttgagaccaagttg
gatctggagaatgctcctgcgtgcatggagctgctgttcaagaacagctggtatcaggcc
aacctctccagcccaccacaggtccccaacatcgggtggcagccgcatcaggaggtgatg
ttgggatattccgactccgccaaggatgctggtcgtctggcatctgtgtgggggctgcat
aaggcgcaggaagctctggtggagctcagccacaagtacaagatcaagctgaatctcttc
catggtagaggagggtcagtggggagaggaggtggtccgcaatacttggccaccttgtca
cagccggctggatctgttcaaggctggatgcgtgtcactgtgcagggagaggttattgac
cactactttggtcttccatcaatcgcttctcacaccatggagagatacactacttcggtg
cttactgcaaccctcacccctcctaaggctccttcagatgacttccgtgagatcatgcag
cggctgtccgagacgagttgcaacaagtacaggtctctcgtgtttgaagacccggagttc
atcgagtacttccgtacggcgacaccggacttcgagctcaagggcctcaacctgggatct
cgaccgtccaaacgcaagcagggaggaatagagtcgctccgagcgatcccgtggatgttt
gcatggactcagactaggctgcagctgccggtttggttgggagttggaacggctctgaaa
gccgagattgacaacgggaacctcaaaactcttcaagatatgtataacgactggcccttt
ttccgctccacggtcgagctgcttgagatggtgttggcaaagactagcaagaccattgct
gattactacgagtcgctgctggttcccgaagatctccagagcgtgagctccaaagtgtgg
gaagagttcgagaatacgatgaagagcatccttcaagtgatccggcacgagcacatgctc
gagggcgacagctccttgagcagcaggcttgccatcgccacccgcgtccctctcgtcgac
cccatcaacgtcctgcaggcgaacgcgctggtgaggatgagggcggacgaaaaccagccg
gacattcacgtgctgcgcgatgcctttgcgatcaccgttcagggagttgcggcaggaatg
ggatggacaggatga

DBGET integrated database retrieval system