KEGG   Guillardia theta: GUITHDRAFT_105481Help
Entry
GUITHDRAFT_105481 CDS       T02925                                 

Definition
hypothetical protein
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
gtt  Guillardia theta
Brite
Enzymes [BR:gtt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     GUITHDRAFT_105481
Protein kinases [BR:gtt01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   GUITHDRAFT_105481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 466 aa AA seqDB search
MQHFNIQDIFKLPAVTSLNNVEIPVRKNCEQNPPRHEMQSAKQLDDWKNAPICNPYAGPK
ELYAVENAVVKEYDPILKQWRQNAIKIQIERKPFAEGAMRSAYRMKILDGMDVHGRDRLF
VLKLSKDPKENVKQYYKDVETQMEARKWAIDYNKSGAPKQVEFIPAMVVILVDRPLRPTC
TMEKFVEGEYVKYNDNWSWCDEKRNTPQAFSHWTWEASGNNLLVCDLQGVGDCWTDPQIH
TIDGRGFGKGNAGLQGIRQFLQQHKCNAICRALKLKSLTGRMKLADNGTQWGAALKKRTA
MEPAASGSSLDDMPVGIGITIDGGFSQGLMLPLIVVAVKPGSVAAKSGKIQKGDFIIQVD
KTPVQGASVSQVKHLIQGKAGTKESREQKKRKVNNKDVHQIVKEMLFQTKPEDKQEQKEL
EEQHHNPEPRPIKVMNGPAQPQVEKENNNRNLKVNPQALQGGIVFI
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacttcaatatacaagacatcttcaaactgcctgctgtaacgtctttgaataat
gtggagatcccagtaagaaagaattgcgagcaaaatcctccccggcacgagatgcaaagt
gctaagcagctcgacgactggaagaatgctccaatctgcaacccatacgctggtcccaaa
gaactgtatgcagtggagaatgcggtcgtgaaggagtatgatcccatcctcaaacaatgg
aggcaaaacgcgatcaagattcagatagagagaaagccctttgccgaaggtgctatgcgg
tctgcatatcgcatgaaaattcttgacggcatggatgtgcatgggagagatcgcctgttt
gttctcaagctctccaaggacccgaaggaaaacgtcaaacaatactacaaggatgtcgag
actcagatggaagcgcgaaaatgggcgatcgactataacaagtcaggagcccccaaacaa
gtggaattcattcctgcgatggttgtcatcctggtagaccggccgctccgtccgacatgc
accatggagaagtttgtggagggggagtacgtcaagtacaatgacaattggtcttggtgt
gacgagaagaggaacactccacaggccttctctcactggacctgggaggcctcagggaac
aacctgctcgtgtgcgatctgcagggcgtaggagactgctggactgacccacagatccac
accatcgatgggagaggattcgggaagggaaatgctgggctgcaaggaatcaggcagttc
ttgcagcaacacaagtgcaatgctatctgcagagccctcaaactcaagtcgttgacgggg
agaatgaagcttgccgacaacgggacgcaatggggtgcggcattgaagaagagaaccgcc
atggaacctgctgccagcggctcctccttggacgacatgcccgtcggtatcggaatcaca
atcgatggtggatttagtcagggcctgatgctcccgctgatcgtcgtggccgtgaagcct
ggcagcgtcgccgccaagagcgggaagatccagaagggagacttcatcatccaagtagac
aagacccctgtccagggcgcgtcggtctcgcaggtgaagcatctcatccaagggaaggcc
ggcaccaaggagtctcgagagcagaagaagcgaaaagtcaacaacaaggatgttcatcag
atcgtgaaggagatgctgttccaaactaaacccgaggacaaacaagagcagaaggagctt
gaagagcagcaccacaacccggagccgaggcccatcaaggtcatgaacggaccggctcaa
ccacaagtagagaaagagaataacaacaggaacttgaaggtcaacccgcaggccctgcag
ggaggaatcgttttcatctga

DBGET integrated database retrieval system