KEGG   Guillardia theta: GUITHDRAFT_132707Help
Entry
GUITHDRAFT_132707 CDS       T02925                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
gtt  Guillardia theta
Brite
Enzymes [BR:gtt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     GUITHDRAFT_132707
Transcription machinery [BR:gtt03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     GUITHDRAFT_132707
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 384 aa AA seqDB search
MVAASGVAGAGAGAGAVAGTATAEEAEIKSRDFTAKQEEEAGILHFKCVWNDGRPTSLRF
LCELKEIFGTQLPKMPKEYIVRLVFDKNHKSICAIKTVDGVQKAIGGICYRPYYEQKLGE
IAFCAVSTEQQVRGYGTRLMNQTKHYCKTRDNLDHFVTYADNYAIGYFKKQGFHMQISMH
RDRWAPNIKDYEGGTLMECYINPHIDYLEIPSMVKRQRKAVEDKISQLTRHDIVYPGLNC
FKEGKDSIELESIPGVLEGGPALKRHLTEFYQERESNAELLKQTLNEILANTTKYDQAWP
FLEPVRAEDVPDYHDVIKDPIDLSAMRVRLDKGFYKTKEMFMADINLMCDNCKTYNPKES
VFYKCATDVKKFVDDEFRRLGLCQ
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggtagcagcatcaggggttgcaggagcaggagcaggagcaggagcagtagcaggtaca
gcgacggcggaagaggcagagatcaaatccagagacttcacagcaaagcaggaggaggaa
gcagggattttgcatttcaagtgtgtgtggaacgatggcagacccacaagccttcgattt
ctgtgcgagctgaaggaaatctttgggacgcagctccctaagatgcccaaggagtacatc
gttcgtctcgtcttcgacaaaaaccacaagtctatctgtgctataaagaccgttgacgga
gtccagaaggccattggggggatctgctaccgtccttactacgagcagaagttgggagag
attgcattttgtgcggtgagcacagaacagcaagtcagggggtatggcacgagattgatg
aaccaaacgaaacactactgtaagacaagggacaacctggaccactttgtaacatatgcc
gataactatgccattggctacttcaagaagcagggctttcacatgcagatcagcatgcat
agagatagatgggcgccaaacatcaaagattatgagggcggaacgctcatggagtgttac
atcaacccgcacatagattatcttgagatcccttccatggtgaaacggcagcgcaaggcg
gtagaggacaagatatctcagttgaccaggcatgacattgtttatccgggactcaactgt
ttcaaagaagggaaggatagcattgaactagagagcattccgggcgttcttgagggaggt
cccgcgctgaaaagacatttgactgagttttatcaggaaagagaatccaacgctgaactg
ctgaagcaaactctgaatgaaatccttgcaaacactacgaagtacgatcaagcctggccc
tttcttgagccggtcagagcagaagacgttcctgactatcacgatgtcatcaaagatccc
attgacttgtctgcgatgagggttcgacttgacaagggattctacaagacaaaggaaatg
ttcatggcagatatcaacttgatgtgcgataactgcaaaacttacaacccaaaagaatcg
gtcttctacaagtgcgcgactgatgtgaagaagtttgtagatgatgagtttcggcgactt
ggcctctgccagtga

DBGET integrated database retrieval system