KEGG   Guillardia theta: GUITHDRAFT_142658Help
Entry
GUITHDRAFT_142658 CDS       T02925                                 

Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
gtt  Guillardia theta
Brite
Enzymes [BR:gtt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     GUITHDRAFT_142658
Transcription factors [BR:gtt03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    GUITHDRAFT_142658
Mitochondrial biogenesis [BR:gtt03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    GUITHDRAFT_142658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1260 aa AA seqDB search
MSSAWAARSRRTHGSRIEEEIECAEEASLEAFAERFKGYQATHAFQGEDTVFGSGGFLLG
RSDLYQEKLLDEIQGTKSEAKSGTVQRILNQKVVFLKVTKVYKNITLPKKSWFPVTVTQV
SRIKTIKKYLDEDEDILSLESDQSGVSCTMLVEEVKGWVLLRLDTGEEGWYPAAFVKSMR
RFIEIEGEQEKVLVGSGKRIRRQTDRLSPTWSSDDESKSAAETKVVASTERISTRNTKVD
SNEDEWKDPCAMCFNPAKKLGNAKTIALICSRCEGIIKQGWPFWQHCDPPEHEPGHPVSI
VNMCIYCFQVVQRDGMYTPPKEETEGAKVAAPPDEAKSKVILATEFTSKVVEQDVESMCE
CPFCGRKYHDRCVRYNREMYGDIPPRCIHRDCQDKWNSLAKPQLNCLYLNLRARDMKESP
LSQHMQSYVAKKVFKGLEKSCPVIIRTVSNVKRMQESTPGFTARFGKQNFPYLLKNIMCF
VECEDETDVAFLGLVVAEFGSDAPEPNKNKAYISYIDSVQLYHKASCCLRGRDVCSSSTC
SDPEECTRERKEVVRRVLLGYLDAVKKRGFEALFIWSMPPNDLHHDYIFHMRPLHQHCPT
PAQLDSWYAKLLNVAKQEGIITDWDSNARRDEDGEQDRSLPRSLFGPDMSLRHVPQFPGG
LMLRALEAALSGGDAKLTSSATPSRPETSKRARAEVTPPADSGPSRSEGRRISRELTIQS
HERHQRAVEAMNKYMQRNSEMGSIFMVQYSKDKAGSGKSKSSSKHREETLEEDPLVNVDE
DKHEFTLNECAHLCTLLNDLHLQFNDMRHGKFSTMMMIHRLVRQLLIKSESLKKAHPAPA
TVRGRILDVADALLHRLGGSSGSVRQVFRSTNGASPKDEIQRGGSKEWREESKLWKAMKR
ASHHVSEETEDSVRELTARQRRNLNDAADAAASHKCNSRCADGKCNKYDWEFACPVVCRW
QHTCCMREDPLVCFDEAIEARDICYDTDYNYMCHLCSAMPQVVAIRSKGRHKDPIILRKE
PLKRKRGRPPIRRDAEETKKREEDAKLAIARSSGSSDHVRPYKLAKTAGSDGKAGGEESK
SREAQPPSARGKKKRRGYKFTHIKNTKIRSKGEGAGREAEEAVKETQSSGKKARKREVDA
ESVGDSGSRRSSIPGITDKDTRDEIYLSRFEHKTSKSRFFVGQNVECEDRGAFYQAEIKS
IDNSLRTQRVLVHFKGWSIRYDVWLAADSSRAFSSQSDTFRKDTDEDPAGIRPLAESKTS
NT seq 3783 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtgcctgggctgccagatctcgcaggacacatggctcgaggatcgaggaagag
atcgagtgtgccgaggaggccagcctcgaggcgttcgcagagagattcaaaggatatcaa
gcgacccatgcgttccaaggggaagacacggtcttcggaagtggaggttttctgttggga
aggagcgacctttaccaagagaagctcctcgacgaaatccaaggtacgaaatcagaggca
aagagtggtactgttcaaaggatattgaaccaaaaggtggttttcttgaaggtcaccaag
gtttacaaaaacatcacacttccaaagaagtcatggtttcctgttaccgtgacgcaagta
agccggataaagaccatcaagaagtatcttgatgaagatgaagatattctttcacttgaa
tcggatcagtcgggagtgagctgtaccatgcttgtcgaagaggttaagggatgggtattg
cttcgcttggatacaggagaggaaggatggtatcctgctgcgtttgtaaagtccatgcgt
cgattcattgagattgagggagagcaagagaaagtacttgttgggagtggaaagagaatt
cgtcgtcagaccgataggttatctccgacttggagcagcgatgatgagagtaagtctgca
gcggaaaccaaggttgtcgcctccactgaacggatctcaacgcggaataccaaggtagac
agcaacgaggatgagtggaaagatccttgtgctatgtgcttcaaccctgccaagaaactt
ggaaacgccaagaccatcgcactcatatgtagcaggtgtgagggtattatcaagcaaggg
tggcccttctggcaacattgcgatccacccgagcacgagcctggtcaccccgtgtcaatc
gtcaacatgtgcatctattgcttccaggtggttcaacgtgatggaatgtacactcctccc
aaggaagagacagagggagccaaggttgctgcccccccggacgaggcgaaatcgaaggtc
atacttgcaacggagttcacttccaaagtggtggagcaagatgtggaatctatgtgcgaa
tgccccttctgcggcaggaagtaccacgaccgttgcgttcgatacaatcgggagatgtat
ggagacattcctcctcgatgcatccacagagactgtcaagacaagtggaactcgctagcg
aaaccacagctgaactgcctgtacctgaacctgagggcaagggacatgaaagagagcccc
ctgtcgcagcacatgcagagctatgtggcgaagaaggtgttcaagggcttggagaagagc
tgccctgtgatcatcaggacggtcagcaacgtgaagagaatgcaggagagcacgccaggc
ttcactgcacgtttcggcaaacagaacttcccatacctgctgaagaacatcatgtgcttc
gttgagtgtgaggacgaaaccgatgtagcatttctgggactggtggtggcagagtttgga
tcagacgctcccgagccgaacaagaacaaggcttacatctcctacatcgactccgtccag
ctttaccacaaggcctcgtgctgcctgcgggggagggatgtctgcagcagtagcacctgc
tcagaccctgaagagtgcacccgagagaggaaggaggttgtccgcagagttctacttgga
tacctggatgctgtgaagaagcgagggttcgaagccctttttatatggagcatgccgccc
aacgatctgcatcacgattacatcttccacatgcggccgctgcatcaacattgccccact
cctgcacagctcgactcgtggtatgcgaagctcctgaacgttgctaagcaggaggggatc
atcacggactgggacagcaacgcccgtcgggacgaggatggggagcaggataggagtctt
ccccggtcgcttttcgggcctgacatgtcgttgcggcacgtcccgcagttcccaggaggg
ctgatgcttcgagcgctggaagccgccttgtcgggaggagatgcgaaactgacgtcatca
gccactccgagcagaccagaaacgagcaagagggcgagagctgaagtgactccccctgct
gatagcgggccttcgcgctcggaggggaggaggataagccgagagctgaccatccagagc
catgaaaggcaccagcgggcagttgaggcgatgaacaagtacatgcagcggaacagtgag
atggggtcgatcttcatggtacagtactccaaggacaaggccgggagtgggaagagtaag
tcgagcagcaagcatcgggaggagaccctcgaggaagaccccctggtgaacgtggacgag
gataagcacgagttcaccctgaacgagtgcgcgcacctatgcacgctgctcaacgacctc
cacctgcagttcaacgacatgcgtcacggcaagttctccacgatgatgatgatccacaga
ctggtacggcagctcctcatcaagtcggagagcctgaagaaggcgcatccggcgccagcg
actgtgcgaggaagaatcttggacgtggctgatgcgttgctgcaccgccttggcggcagc
agtggaagtgttaggcaggttttcaggtcgaccaacggagcctcgcccaaggacgagata
cagcggggaggcagcaaggagtggagggaagaatcgaagctgtggaaggcgatgaagagg
gcgagccatcacgtttcggaggagacggaagactctgtccgtgagctgacagcacgtcag
aggagaaatctgaatgacgcagccgatgctgctgcctcgcacaagtgcaacagcagatgc
gccgacggcaagtgcaacaagtacgactgggagttcgcgtgcccggtggtgtgccgctgg
cagcacacttgctgcatgcgggaggacccgctcgtgtgcttcgatgaggcgatcgaggct
cgtgacatctgctacgacacggactacaactacatgtgccacttgtgctcggccatgccg
caggtggtggcgatcaggagcaagggaaggcacaaggatccgatcatcctgcggaaggag
ccgctgaagcggaagaggggaaggccgccaattcgccgggatgcggaggagacgaagaag
cgagaggaggacgcgaagctagcgatcgcgcggtcgagcggatcgagcgatcacgtgcgt
ccttacaagcttgcaaaaacggcgggaagcgatgggaaggcaggaggagaggagagcaag
agtcgcgaggcacaacctccttcagcgcgcgggaagaagaagaggaggggatacaagttc
acacacatcaagaacaccaagatcagaagcaaaggagaaggggcagggcgagaggccgag
gaggctgtcaaggaaacgcagagctcaggcaagaaggcgcgaaagagggaggtggacgcg
gagagcgtaggagacagcgggtcgaggaggagctcgatccctgggatcaccgacaaggat
accagggatgagatctacctcagccggttcgagcacaagacttccaagagtcgcttcttc
gttgggcagaacgtcgaatgtgaagatcgtggagccttctaccaggcagaaatcaagagc
atagataacagcctcaggacgcagcgggtgctcgtgcacttcaaaggatggtccatccgc
tacgacgtctggctcgcagcggatagctcccgtgcgttctcttctcagtcggacactttt
aggaaggacactgacgaggaccccgcaggaatccgcccgctcgccgagtccaaaacgtca
tga

DBGET integrated database retrieval system