KEGG   Guillardia theta: GUITHDRAFT_144591Help
Entry
GUITHDRAFT_144591 CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
Organism
gtt  Guillardia theta
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 258 aa AA seqDB search
MQAVRRAKKLYVSSCLATSGHRYFAHMSFKTTKLFELLLAMTVQVSASNENIVYWINFHE
FHHQACETEDDIHTPWRMGFWAVQLQDSSANLVTTQELEIKACEHLFWLLCGKDVFFWGC
LVPNVLHFHAIRLTNSAAHLWGYRPYVAQFQSECKATNNWWVAIFNGGEGWHNNHHAFMG
SAKHGFMWWEFDWVYFGLLILGKLGVVWDIKVPTQEVLEARYKGSSKRDLGIKRLYRLEC
ESAESKRKLTAQPAAWLL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcggtgaggagggccaagaagctctacgtctcctcatgtctcgccacgtcaggg
cacagatacttcgcgcacatgtcgttcaagacgaccaagctcttcgagctgttgcttgcc
atgacggtccaggtatcggcatcgaacgagaacatcgtctactggatcaacttccacgag
tttcaccatcaagcctgcgagactgaggatgacattcacacgccctggaggatggggttc
tgggctgtgcagcttcaggattccagtgcaaatcttgtcaccactcaagagttggaaatc
aaggcgtgcgagcatctcttctggttgctatgcggcaaggatgtgttcttctggggttgc
ctcgtgccaaatgttctgcatttccatgcaatcaggttgaccaattctgctgcccacctt
tggggttatcgaccatatgtcgctcaattccaaagtgaatgcaaggctactaacaactgg
tgggttgcgatcttcaacggcggcgagggatggcacaacaatcatcacgccttcatggga
agcgccaagcatggtttcatgtggtgggagttcgactgggtgtactttggtcttctcatc
ctcggcaaactcggagtcgtgtgggacatcaaggttccaacccaagaagttctggaagct
agatacaaggggagctccaagcgagaccttggaatcaaacggttgtaccgcttggagtgt
gagtcagccgaatcgaagcgaaagttgacggcacagccggcagcatggcttctatga

DBGET integrated database retrieval system