KEGG   Guillardia theta: GUITHDRAFT_145081Help
Entry
GUITHDRAFT_145081 CDS       T02925                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
gtt  Guillardia theta
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtt00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    GUITHDRAFT_145081
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    GUITHDRAFT_145081
Enzymes [BR:gtt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     GUITHDRAFT_145081
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 887 aa AA seqDB search
MYRISSEGAVIPPPVGMRSSSPLGGLGTGSVELRSDGSFRDWLVDNEGPGLCEICKRSIK
EEMVLAVKASSAENGWEVAKALTTKTVRLSEHELLPTVDELVYRGGFPVSSMQVADRSFP
LNLTLFAYSPFSPFDVAMSSIPSIAFELLVDNPTRSACNVTFGLTLPLLAEKDVVRLPFQ
TATVVGMTGHVRKESRFEGVFTVVGLEEEEEAKLVGCELKVSTGHGSSSEWRGRVLDVRR
SDSERQQVTWTSSSLHSAQVNQSVLLLQCEVREDGDVLAVLPGMPSLSACRTACEEALEC
LCWSALPVNEGLKCVLLRTVYPARWRAGGWAGVRGEWRVQDTSGMRRKEGGEEEEEEEEK
AEMNAARVGLQVRREGESHASGELMVVGLTEREEGGGGREDAVHASCTAALARAPTALSS
CMAHTEDTAYGRKWKEKEGRDVGNAYATRFSSAQARRDAAEYHLRHEPRILRTISSWNKI
FAESSLDHPLIDFLMNSVSNFIKTGFLTADGRWRQFESFSCNDEPVHLHLYRSIPLALLF
PQLVRNILDTGPIDEPKFPCGSRMMGDSNPGFVLSVLNLFMSTGDRRVLLDFLEPVMSSR
FGLPRHLQNTYDWFHFHLKDVSAYNAVLYLAQLAAAERIAALVQDDSFQHYCQLHLSKAQ
EKVKELLWNGRFLRAWWNEEGELVEALHTETLYGQLWAFQLNLGLLLPREMLLSHLEAEM
GIASTKFGLLVMSNYSGRGDRKAGRDNLIWEAGSLTWSTLSVFLDVPLARALLPLSNVLD
KYRRHLQDLWDWRDLTAGPGMDASGECGKKPPGVSVDGQPWCNSHYSRQLIGWSILSALS
RGFYDPSQLKLSFEPADGCPRERRVTRSLSHCSLAEDEGSFSCSWAK
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgtatctcgagcgaaggggcggtaattcctcctcctgttggcatgcgatcgtcc
tcccccctcgggggcctcgggacagggtcagtggagctgcgatcagacggatctttcagg
gactggctggtggacaacgagggtccagggctgtgcgagatctgcaagaggagcatcaag
gaagagatggttctagctgtgaaagcttcaagtgcagagaacgggtgggaggtagccaag
gccctgacaaccaagactgtgcgactgagcgagcacgagctgctgcctacggtagatgag
ctggtatacagaggaggcttcccagtgtcaagcatgcaggtagcggacaggagctttcct
ctcaacctgaccttgttcgcttactctcccttctccccgttcgatgtcgccatgtcttcg
atcccttccatcgctttcgagctcctcgtcgacaaccctacgcgctcagcgtgcaacgtg
acgttcggcctgacgctgccgctgttggctgagaaggatgtagtgcgcctgccgttccag
actgcaacagtcgtcgggatgacggggcacgttaggaaggaaagtcggttcgagggagtg
ttcactgtggtggggctggaggaggaggaggaggcgaagctggtgggatgcgagctcaag
gtttcgacggggcatgggtcgagctctgaatggagggggcgagtgttggatgtcaggagg
tctgatagcgaacgacagcaagtaacctggacctcgtcctcactgcatagcgcgcaggtg
aatcagtccgtcctcttgctacagtgcgaggtgcgggaggatggagatgtacttgcggtc
ttgccgggcatgccctccctctctgcctgcaggacagcatgtgaggaggcactggaatgc
ttgtgttggtcggcgctgcctgtcaatgaagggctaaaatgcgtcctgttgcgcacggtc
taccctgcgagatggagagccgggggatgggccggagtgagaggagaatggcgggtgcag
gatacctcggggatgcgacgcaaggagggtggagaggaggaggaggaggaggaggagaag
gcagaaatgaatgctgcaagggttgggcttcaagtacgacgtgagggagagtcgcacgcg
tcaggagagctcatggtggtcgggctgacggagagggaggagggagggggagggagggag
gatgcggtccatgcttcttgtaccgcagctctagcacgtgcgccaacagctctcagctcc
tgcatggcgcatacggaggatacagcatacggcaggaagtggaaggagaaggaaggaaga
gacgtcggcaacgcttacgctactcgcttctcctcagctcaggctcgtcgtgatgcagct
gaatatcacctccgccacgagccccgcattctccgaaccatctcctcctggaataagatt
ttcgcagagagcagtttggatcatccgctcattgacttcctcatgaacagcgtctccaac
ttcatcaagactggcttcctgactgccgacggacgatggcgccagttcgagtctttctct
tgcaatgacgaacctgtccacctccacctctaccgctctatccccctcgcccttctcttc
cctcagctggttcgaaacattctggacacaggtcccatagatgagcccaagtttccttgc
ggctcgaggatgatgggagattccaaccccggcttcgtgctcagcgtcctcaacctcttc
atgagcactggcgatcgccgcgtcctcctcgacttcctggagcctgttatgtcctcacgc
ttcggccttccccgacaccttcagaacacctacgactggtttcactttcacctcaaggac
gtttccgcctacaacgccgtcctctaccttgcccagctcgcagcagcagagaggatcgca
gctctggtacaagacgactcgttccagcactactgccagctccacctcagcaaggcacaa
gagaaggtcaaggagctcctctggaacggcaggtttcttcgcgcatggtggaacgaggag
ggggagcttgtcgaggctcttcacacggaaaccctctacgggcagctttgggccttccag
ctcaaccttggcctgctgctgccgagggagatgctgctctcgcacctggaggcggagatg
gggatcgcgtccaccaagttcgggctgctggtcatgtcaaactactctggacgaggggac
aggaaggcagggagggacaacctgatctgggaggcgggctcgctcacgtggtcgacgctc
tccgtcttcctcgacgtgccgctcgctcgcgccctcctccccctctccaacgtcctcgac
aagtatcgccgtcacttgcaagacttgtgggactggagggacctgacggcggggcccggc
atggacgcgagcggagaatgcggcaagaagcctcctggagtgtcagtagacggacagcca
tggtgtaactcccactactcccgtcagctgatcggatggagcatcctctctgcgctgagc
cgaggattctacgacccttcccagctgaagctgagcttcgagccagctgacggatgccct
cgggagcggcgggtgacccgctcgctctctcactgctctcttgctgaggatgagggaagt
ttcagctgctcctgggccaagtag

DBGET integrated database retrieval system