KEGG   Guillardia theta: GUITHDRAFT_149086Help
Entry
GUITHDRAFT_149086 CDS       T02925                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
gtt  Guillardia theta
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 654 aa AA seqDB search
MMIYNKPLSSAAFLAGGSLAMAMILYIFRKKSKSATSLATFTLGKAKPKTKVMKGVVEPP
SRTASSELTGPVIWVHFGSQTGTAEEFAKIIVKEGRKQRMNMKLVDLEKFDASRFPGSFG
IFLVATYGEGEPTDNAKQFYHWLLERSGGNSCSGMQYAVFGLGNTQYEHYNAFGKLLDST
FEREGGKRMLKLGLGDDDKNIREDFEDWVKKLWPALSEHLGLEQSSQQWMDEGVQYKMQV
KAHGYTKPATNGCSFQSSNALDAVHVETLRVRENRELNKGGERSCRHVEFDILAPAVGYE
TGDHLAIFPENDMSMVKALAARLQVDLSLYITVKDSDGFSPFPCPCTVEEAFARYLDINS
LPRKSFLVALAEFARDGSERERLLKLASKEGQDLYHQYVVLETRNLLDLLNDFPSVQPSL
ECLVELVPRLQSRYYSISSSNLVHPRCVHVTAVVVEKKYQDGRSFHGVCTSYLRRLHQGD
IVRAHLRKTNFKLPREVSTPVILVGAGTGIAPLRGMCQELEHRKRMLAPIGKNLLFFGCR
RPTEDYLYEEEIGGWLENGTLSRVHTAFSRSNDTLGGGKVYVQQRVDENAIQLLSLLDAG
ACIYVCGSTAMARDVKRVLCQSLIFLRRMKGNGAEAFLEDLAKEGRYHQDVWTT
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgatgatctacaacaagccattaagctcagctgctttcttggctggggggagccttgct
atggctatgatcctgtacatattccggaagaagagcaagtcagctaccagcctagccacg
ttcactcttggcaaggcaaagcctaaaaccaaggtgatgaaaggagtagtcgaacctccg
agcaggactgcttcgagtgagctgaccgggcccgtcatctgggtgcacttcggtagtcag
actggaacagctgaggagtttgctaagatcatagtgaaggagggcaggaagcagaggatg
aacatgaagctggtcgatcttgagaagttcgacgcctctcgcttccctggttccttcggg
atctttcttgtcgctacctacggggaaggagaacctacggacaatgcgaaacaattttac
cactggctgctggaaaggagtgggggcaattcctgctcggggatgcagtatgctgtcttt
gggttgggaaacacgcaatatgagcattacaacgcttttggaaagctgctggactcgaca
ttcgagagggagggagggaagagaatgctgaaactcggtctaggggatgatgacaagaac
atccgagaggatttcgaagactgggtgaagaaactgtggccagccctttcagagcatcta
gggctggagcaatcaagccaacagtggatggatgagggagtccagtacaagatgcaggtg
aaggctcatggatacacgaagcctgcgaccaacggttgcagcttccagtcatccaacgcg
ctggatgccgtgcatgtggagacgctgagggtgagggagaaccgggagctgaacaaggga
ggagaacgatcttgccgccacgtggagtttgacatcttggctcccgctgtggggtatgag
accggggaccacctagctatcttccctgaaaacgacatgagcatggtgaaggcacttgcg
gctcggctacaggtggatttgtccttgtacatcacggtgaaagactcggatggcttttct
cccttcccatgcccttgtacagtagaggaagcctttgcaaggtatcttgacatcaactca
ctcccgcggaagagtttcctggtggctcttgctgagtttgcacgtgacggatcggaaaga
gagcgattgttgaagctagcttcaaaggagggacaggatttgtatcaccagtatgttgtg
ttggagactcgcaatcttctggatctcttgaacgactttccatcagtgcagccttcgctg
gagtgcctggtggagctggttcctcgcctgcaatcgcggtactactccatctcttcctcc
aatctcgtgcatcctcggtgtgtccacgtcactgcagtggtcgtggagaagaaatatcaa
gacggaaggtccttccatggggtctgcacgagctacctcaggcgcctgcaccagggagac
atcgtccgagctcatctgcggaagacaaacttcaagctcccaagggaggtctcgaccccg
gtgatccttgtcggcgcggggacagggatcgcgccattgcgggggatgtgccaggagttg
gagcataggaagcgcatgctagctccgatcggcaagaatctgctattctttggatgtcgt
cgaccgaccgaggactacttgtacgaggaggagataggagggtggctggagaacgggact
ctcagccgtgtacatacagcattcagcaggagcaacgacacgctcggtgggggcaaggta
tacgtccagcagagagtggatgagaacgcaatccagcttttgtccctgctggatgctggt
gcctgcatctacgtctgtggcagcacggcgatggcgcgggatgtgaagcgcgttctttgc
cagtcgctgatcttcttgaggaggatgaaagggaatggagctgaggccttcctggaagac
cttgcgaaagagggcagataccatcaagacgtgtggactacatga

DBGET integrated database retrieval system