KEGG   Guillardia theta: GUITHDRAFT_158764Help
Entry
GUITHDRAFT_158764 CDS       T02925                                 

Definition
hypothetical protein
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
gtt  Guillardia theta
Brite
Enzymes [BR:gtt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     GUITHDRAFT_158764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 308 aa AA seqDB search
MPADFGASSYASRLTPRTEKGGGLGLPEHAEEEEITASKILKLADLIRTSKKCVVLTGAG
ISTSAGVSDFRGPNGVWTAEKKGIPPPASRSFETVQPTLTHMALLGLVQAKMNVDGLHLR
SGLPRENLAELHGNLFIESCEICGWEYLRDFDVGGISFSKTGRECERPGCGGALRNNLLD
WEDALPEQEFQAAEDALRSSDLCICMGTSLRIRPASELPLITVKNGGKLVLCNLQKTPKD
RHACLKVHAPIDEVMRGVMAVLGVRIPKLYIRLTTVKKMSKSKRKELVGIRTRREPLRRK
KAENHRAQ
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgccagcagacttcggagcaagctcttacgcaagcaggttgactcctcgtacggagaag
ggaggagggctgggccttccagagcatgcggaggaagaggagataacagcatccaagatc
ttgaaactcgccgacttgatcagaacctcgaagaagtgcgtggtgctgacaggcgctggg
atctcaacgagtgcgggcgtctctgacttccgagggcccaatggagtttggacggcagag
aagaaaggaattcctcctccagcttcgagaagctttgagactgttcagccgaccctgacg
catatggcgttgttggggttagtgcaagcgaagatgaatgtggatggccttcatcttcga
tcgggtctacctcgtgagaacctagcagagctacacggcaacctcttcatcgagtcctgc
gagatctgcggatgggagtacctgagagacttcgatgtcggaggaatcagctttagcaag
acagggagggagtgcgagcggccgggctgcggtggtgccttgcgcaacaacttgctggac
tgggaggacgctttgccggagcaggagtttcaggcggctgaggatgccctgcggtcgagc
gacctgtgcatctgcatgggaacttcgctgaggatccgtcctgcctcggagctcccgctc
atcacggtgaagaatggcgggaagctcgtcctgtgcaacctgcagaagacgcccaaggac
aggcacgcctgcctcaaggtccacgcgcctatcgatgaggtcatgcgcggggtcatggcg
gtcctgggcgttaggatacccaagctgtacataagactgacgactgtcaagaagatgtca
aagtcaaagaggaaggaactggtagggatacggacgaggagagagccgttaaggagaaag
aaggcggagaatcatcgagcccagtaa

DBGET integrated database retrieval system