KEGG   Guillardia theta: GUITHDRAFT_159544Help
Entry
GUITHDRAFT_159544 CDS       T02925                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gtt  Guillardia theta
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gtt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GUITHDRAFT_159544
Enzymes [BR:gtt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     GUITHDRAFT_159544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 365 aa AA seqDB search
MAGVCVVGSCNFDQKLLLPLTVFLLQTVYVQDIPAPGQTVHGSSYVTGFGGKGANQCVMA
AKLGSSATMISALGDDAIASMTRENLRRSNVSLDHMYVKEGVSSGVAQITVSSKSGENCI
VIVPGANLCLEPEDVERAAEVRSSGQRDGADGFLRSLVEQAISSCKVLLCQNEISPATTY
TAMRIARGSKSPPLVILNAAPAPRVGTNWREGEWRDFKEMLSMCDVLCVNESEAREMSKL
QVEGEDESSLMDSIKRASLTLMELGASQILFTLGERGSCLVRPGDGDTREVKVHRVPAGQ
QRVQVVDTSGAGDAYLGALASHVAAGKSMEQAMEAAGEIATITVQSKGTQNSYPSADSLP
PHLRP
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggtgtgtgtggtggggtcatgcaactttgatcagaagcttctgcttcctctc
actgtcttcctcctccagaccgtctacgtgcaggatatcccagcaccaggtcagaccgtc
catggctcctcctacgtgaccgggttcggagggaaaggagcgaatcaatgcgtcatggcg
gccaagctggggagcagcgcgacgatgatctcagcgctaggggacgatgcgattgcgagc
atgacccgagagaatctgaggaggagcaacgtgagtctcgaccacatgtacgtgaaagaa
ggagtctcttctggtgtcgctcagatcaccgtgagctccaagagcggggagaactgcatc
gtcatcgtgcccggcgccaacctttgccttgagccggaggatgtggagcgggcggctgag
gtgaggagtagcgggcagagagatggtgctgatggttttcttcgctcgctggttgagcag
gcgatatcgagctgtaaagttcttctctgtcagaatgagatatccccagcgacgacgtat
actgccatgagaatagctcgagggtccaagagccctcccctcgtcatcctcaacgctgct
cctgctcctagagttgggaccaactggagggagggcgagtggcgggacttcaaggagatg
ctctccatgtgcgacgtcctctgcgtcaacgagtcagaggcgagggagatgtccaagttg
caggtggagggcgaagacgagtcttctctgatggattccatcaagagagcatcgctgaca
ttgatggagctgggagcgagtcaaatcctcttcaccctcggggagcggggaagctgcttg
gtgcgaccgggtgatggagacacgagggaagtgaaagttcatcgtgtgccggctgggcag
cagcgggtgcaagtggtcgacacgtctggagcgggtgacgcgtatctcggagccctggcg
agccacgtggcagcggggaagagcatggagcaggccatggaagcggcgggagagatcgca
accatcacagtgcaatcgaaaggcacgcagaactcgtatccttcagcagacagccttcct
cctcacctccggccttga

DBGET integrated database retrieval system