KEGG   Guillardia theta: GUITHDRAFT_43422Help
Entry
GUITHDRAFT_43422  CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
Organism
gtt  Guillardia theta
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 292 aa AA seqDB search
GGITNKLFRVCMAKTAGGNVPRSVLLRVFGDGGMIDRVAETKCFVELWEAGLGPKCYGRF
KNGRIEEYYEDVKTLTCDDLSEETISRAIAEQLAKTHKTMKLPQDSSRPTLFTQMRQWLV
QARGSHDDMVSLEPDFDISLKWLEERIAEFESSIQDSFAVVFCHNDLLAANILQELADGK
LHFIDFEYGGANYSAFDIANHFNEWAGGTDTGRPDYSKFPTEQQMARFCSHYLRELHGSD
KVESEVAGLLQEVKIFLSINHLYWGLWAINMGTSMGSASFPYFTFARHRLEQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
ggaggcatcaccaacaagttattcagagtttgtatggcaaagacagcaggtggcaacgta
cccagatcagttttgttgagggttttcggagatggcgggatgatagatagagtggcagaa
accaaatgcttcgtcgagctctgggaggctgggttggggcccaagtgctatggaaggttc
aagaacggcaggatcgaggagtactacgaggacgtcaagacgttgacatgtgacgacctg
agcgaagaaacgatatcgcgcgcgattgcagagcagttggccaagactcacaagaccatg
aagctccctcaagacagcagcagaccgactctcttcacgcagatgcgccagtggctggtg
caggcaaggggcagtcacgacgacatggtgtctctggagccagactttgacatttcgttg
aagtggctcgaggaaaggatcgcggagtttgaaagctccatacaggacagcttcgccgtc
gtgttctgccacaatgatcttctcgctgctaacatcctgcaagagctggcggacgggaag
cttcacttcatcgacttcgagtacggcggggccaactacagcgccttcgacattgccaac
cacttcaacgagtgggcaggaggtacagacactggtcggcctgactactccaagttcccg
acagagcagcagatggcgagattctgctcgcactacctccgtgagctgcacgggagcgac
aaggtggagagcgaggtggcagggctgctgcaggaggtgaagattttcctgtcgattaac
catctgtactgggggctgtgggcgatcaatatggggacgtcgatgggtagcgcctccttc
ccttacttcaccttcgcaaggcacaggttggagcag

DBGET integrated database retrieval system