KEGG   Guillardia theta: GUITHDRAFT_43422Help
Entry
GUITHDRAFT_43422  CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
Organism
gtt  Guillardia theta
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase DUF1679
Motif
Other DBs
NCBI-GeneID: 17289271
NCBI-ProteinID: XP_005819523
JGI: Guith1_43422
UniProt: L1I8I8
Position
Unknown
AA seq 292 aa AA seqDB search
GGITNKLFRVCMAKTAGGNVPRSVLLRVFGDGGMIDRVAETKCFVELWEAGLGPKCYGRF
KNGRIEEYYEDVKTLTCDDLSEETISRAIAEQLAKTHKTMKLPQDSSRPTLFTQMRQWLV
QARGSHDDMVSLEPDFDISLKWLEERIAEFESSIQDSFAVVFCHNDLLAANILQELADGK
LHFIDFEYGGANYSAFDIANHFNEWAGGTDTGRPDYSKFPTEQQMARFCSHYLRELHGSD
KVESEVAGLLQEVKIFLSINHLYWGLWAINMGTSMGSASFPYFTFARHRLEQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
ggaggcatcaccaacaagttattcagagtttgtatggcaaagacagcaggtggcaacgta
cccagatcagttttgttgagggttttcggagatggcgggatgatagatagagtggcagaa
accaaatgcttcgtcgagctctgggaggctgggttggggcccaagtgctatggaaggttc
aagaacggcaggatcgaggagtactacgaggacgtcaagacgttgacatgtgacgacctg
agcgaagaaacgatatcgcgcgcgattgcagagcagttggccaagactcacaagaccatg
aagctccctcaagacagcagcagaccgactctcttcacgcagatgcgccagtggctggtg
caggcaaggggcagtcacgacgacatggtgtctctggagccagactttgacatttcgttg
aagtggctcgaggaaaggatcgcggagtttgaaagctccatacaggacagcttcgccgtc
gtgttctgccacaatgatcttctcgctgctaacatcctgcaagagctggcggacgggaag
cttcacttcatcgacttcgagtacggcggggccaactacagcgccttcgacattgccaac
cacttcaacgagtgggcaggaggtacagacactggtcggcctgactactccaagttcccg
acagagcagcagatggcgagattctgctcgcactacctccgtgagctgcacgggagcgac
aaggtggagagcgaggtggcagggctgctgcaggaggtgaagattttcctgtcgattaac
catctgtactgggggctgtgggcgatcaatatggggacgtcgatgggtagcgcctccttc
ccttacttcaccttcgcaaggcacaggttggagcag

DBGET integrated database retrieval system