KEGG   Guillardia theta: GUITHDRAFT_43422Help
Entry
GUITHDRAFT_43422  CDS       T02925                                 

Definition
hypothetical protein
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
gtt  Guillardia theta
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtt00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    GUITHDRAFT_43422
Enzymes [BR:gtt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     GUITHDRAFT_43422
    2.7.1.82  ethanolamine kinase
     GUITHDRAFT_43422
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 292 aa AA seqDB search
GGITNKLFRVCMAKTAGGNVPRSVLLRVFGDGGMIDRVAETKCFVELWEAGLGPKCYGRF
KNGRIEEYYEDVKTLTCDDLSEETISRAIAEQLAKTHKTMKLPQDSSRPTLFTQMRQWLV
QARGSHDDMVSLEPDFDISLKWLEERIAEFESSIQDSFAVVFCHNDLLAANILQELADGK
LHFIDFEYGGANYSAFDIANHFNEWAGGTDTGRPDYSKFPTEQQMARFCSHYLRELHGSD
KVESEVAGLLQEVKIFLSINHLYWGLWAINMGTSMGSASFPYFTFARHRLEQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
ggaggcatcaccaacaagttattcagagtttgtatggcaaagacagcaggtggcaacgta
cccagatcagttttgttgagggttttcggagatggcgggatgatagatagagtggcagaa
accaaatgcttcgtcgagctctgggaggctgggttggggcccaagtgctatggaaggttc
aagaacggcaggatcgaggagtactacgaggacgtcaagacgttgacatgtgacgacctg
agcgaagaaacgatatcgcgcgcgattgcagagcagttggccaagactcacaagaccatg
aagctccctcaagacagcagcagaccgactctcttcacgcagatgcgccagtggctggtg
caggcaaggggcagtcacgacgacatggtgtctctggagccagactttgacatttcgttg
aagtggctcgaggaaaggatcgcggagtttgaaagctccatacaggacagcttcgccgtc
gtgttctgccacaatgatcttctcgctgctaacatcctgcaagagctggcggacgggaag
cttcacttcatcgacttcgagtacggcggggccaactacagcgccttcgacattgccaac
cacttcaacgagtgggcaggaggtacagacactggtcggcctgactactccaagttcccg
acagagcagcagatggcgagattctgctcgcactacctccgtgagctgcacgggagcgac
aaggtggagagcgaggtggcagggctgctgcaggaggtgaagattttcctgtcgattaac
catctgtactgggggctgtgggcgatcaatatggggacgtcgatgggtagcgcctccttc
ccttacttcaccttcgcaaggcacaggttggagcag

DBGET integrated database retrieval system