KEGG   Guillardia theta: GUITHDRAFT_61079Help
Entry
GUITHDRAFT_61079  CDS       T02925                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
gtt  Guillardia theta
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtt00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    GUITHDRAFT_61079
Enzymes [BR:gtt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     GUITHDRAFT_61079
Exosome [BR:gtt04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   GUITHDRAFT_61079
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 192 aa AA seqDB search
ILPFIFSHASEGNIDEILAAMDEFGKFYPMYKLGSEKGKILEEEIKTRGLSIRTSLEIGT
FFGYSAMRTARNLAAGGHLYCIEYNPAHADVASQLIRYAGLQDSVSIVVGLSGDVIPKVA
DRVKHADFVFLDHNKSLYLPDLKRLQQLNIVGKGTVIAADNVIYPGTPEFLEYVKSGPAW
ETKLVEADFEYD
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atccttcccttcatcttctcgcacgcgtcggaggggaacatagacgagatcctcgcggcc
atggacgagtttggcaagttctatccgatgtacaagctcgggtcagagaaaggcaagata
ctggaggaggagatcaagacgaggggcttgagtatccggacgtctctcgagataggcacg
ttctttggttactctgccatgcggacagcaagaaacttggcagcaggagggcatctctac
tgtatagagtacaatccagctcacgctgacgtcgcgtctcagcttattcgctacgctggg
cttcaagactcggtcagcatagtcgtgggcctgtcaggtgacgtcatccctaaggttgcc
gaccgagtgaagcacgcggactttgtcttcctggaccacaacaagtccctctacctccct
gacctcaagcgcttgcagcagctgaacatcgtcggcaaaggtacagtgatcgcagctgac
aacgtgatctatcccggcacccccgagttcctcgagtacgtcaagagcgggccagcatgg
gaaacgaagttggttgaggcagactttgagtacgac

DBGET integrated database retrieval system