KEGG   Guillardia theta: GUITHDRAFT_73663Help
Entry
GUITHDRAFT_73663  CDS       T02925                                 

Definition
hypothetical protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
gtt  Guillardia theta
Brite
Enzymes [BR:gtt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     GUITHDRAFT_73663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 305 aa AA seqDB search
LDEASLKEHEEVTKIKNVSKVQIGKFVVETWYFSPLPREIWKQDDPPIDVLYFCEFTLNF
YKTKKELERHQLKRKCPRHPPGDEIYRRDNVSVFEVDGAKSKVWCQNLCYLAKMFLDHKT
LYWDVDPFLFYVVCECDDQGCHVVGYFSKEKESEMDYNLACILTFPQHQRKGYGKFIISF
SFELSKIEKKKGTPERPLSDLGRVSYESHWARELLHILKKIGDHPDPTSRTISIEELSDR
TAFKSKDIEDTLRRLQILNYYKGQWIININPRLVEYWLSRCGGPGVPVDPEKIHWMPHIV
HERYL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ctcgatgaagcctccctgaaagagcatgaggaggtgaccaagatcaagaacgtgagcaag
gttcagataggcaaattcgtggttgagacttggtacttctctcccctgccaagagaaata
tggaagcaggacgatccgcctattgacgtgctctacttctgtgagtttactctcaatttc
tacaagactaagaaagagcttgagagacatcagctcaagagaaaatgtcctcggcaccca
cctggagatgagatataccgccgagataacgtttctgtgtttgaagtagacggagccaag
tcgaaggtgtggtgccaaaacctttgctacctcgccaagatgttcctcgaccacaagacg
ctctattgggatgtcgaccctttcctcttctatgttgtctgcgagtgtgacgatcaggga
tgtcatgtggtgggatatttctccaaggagaaagaaagcgagatggactacaaccttgcc
tgcatcctcactttccctcagcaccagcgaaagggatacggcaagttcatcatcagcttc
tccttcgagctctcgaagatcgagaagaagaaagggacgcccgagaggcccctctccgat
cttggccgtgtgagctacgagtcccattgggctcgcgagctccttcatattctcaagaag
attggcgaccacccggatccgactagccggaccatctccatagaggagctcagtgatcgc
acagcctttaagagcaaggacatcgaggacactctccggcgcctccagatcctcaactac
tacaaggggcagtggatcatcaatatcaaccctcgcttggttgaatactggctgtcccgc
tgtggtggtccgggagtcccggtagacccagaaaagatacactggatgcctcacatcgtg
cacgagcgatacctgtaa

DBGET integrated database retrieval system