KEGG   Guillardia theta: GUITHDRAFT_77426Help
Entry
GUITHDRAFT_77426  CDS       T02925                                 

Definition
hypothetical protein
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
gtt  Guillardia theta
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:gtt01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:gtt01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:gtt01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gtt00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 482 aa AA seqDB search
MQYLQSSGKVLTKKNINQNLVEMQYAVRGLVPITAERIQKEILNGDTSKPFKEVLYCNIG
NPHSVGQKPITFYREVLALVDCPMLLEREGVEKLFKPDVIKRAKELIGLIKGGTGAYSHS
QGIEGIRKHVAEFIKGRDGHPAQVGDIFLTNGASSGIQMILTTIIAEPTDAILVPLPQYP
IYSALIKLLNGTQVGYSLDESKGWALNIDELMEKIREARVQGAKPKALVLINPGNPVGNC
LSYDNLVDLVKLCKAEGLVLLADEVYQENIYADRPFVSLKKVVRDLGPEFSGFEFVSFHS
TSKGIIGECGRRGGYMELCGFDPEVQAQIYKLASSGLCSNIDGQVMVDLMIRPPLPGDES
YEDFTRERSAIFDSLKRKSIFLHESLNEIAGVSCQPLKGAMYAFPKLDLPPKAIAAAEGA
KHAPDTFYALSLLENTGICAVPGSGFDGPNHIRLTFLPAEDKLKTAMSHFRRHHEMFVKK
YS
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacttgcagtcgtctgggaaggtgctcacaaagaagaacatcaaccagaacttg
gtggagatgcagtatgcagtccgtggcctcgtgcccatcacagctgagcgcattcagaaa
gagattcttaacggagacacctcgaagccgttcaaggaggttctgtattgtaacattggc
aaccctcattctgtgggacaaaagccgatcaccttctacagagaggtccttgcgctggtg
gactgcccgatgctgcttgagagggagggagtggagaagttgttcaagccggatgtgatc
aagagggcgaaggaactgatcggtctgatcaagggaggaactggagcctactctcacagc
cagggcatcgaagggatcaggaagcatgtagcagagttcatcaagggaagggacgggcat
cctgcgcaggtaggagatatcttcctcaccaacggggcatcaagtggcattcaaatgatc
ctcaccacgatcatagcggaacccacagacgcgattctagtgccactgccccagtatccc
atctacagcgcgctgatcaagctgctcaacgggacgcaggtaggttacagccttgacgag
tccaagggctgggctctcaacatcgacgagctcatggagaagatccgcgaggcgagagtg
caaggagccaaacccaaggccctcgtgctcatcaaccccggcaaccccgtcggcaactgc
ctgagctacgacaatcttgtcgacctggtcaagctctgcaaggctgaaggccttgtgctg
cttgcggacgaggtgtaccaggagaacatctatgctgatcgccccttcgtgtcgctcaag
aaggtcgtccgggacctcgggcccgagttctccggctttgagttcgtctccttccactcg
acatccaagggaataatcggggagtgcgggaggcgcgggggctacatggagttgtgcggt
tttgacccggaggttcaggctcagatctacaagctcgcctcctccggactctgctccaac
atcgacgggcaagtgatggtcgacctcatgatccgtcctcccttgcctggcgacgagtcg
tacgaggacttcacgagggagaggagcgcaatcttcgacagcttgaagaggaagagcatc
ttcctccatgaaagtctcaacgagatcgctggtgtctcctgccagccactcaagggcgcc
atgtacgccttccccaagctcgacctgccgcccaaggccatcgcagcggctgagggcgcg
aagcatgctcccgataccttctacgctctctcgctcctcgagaacaccggcatctgcgct
gtccccggcagcggcttcgatgggcccaaccacatccgactgaccttcctgccagcagag
gacaagctgaagacagccatgtcgcacttccgcagacaccacgagatgtttgtgaagaag
tacagctga

DBGET integrated database retrieval system