KEGG   Guillardia theta: GUITHDRAFT_78124Help
Entry
GUITHDRAFT_78124  CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
gtt  Guillardia theta
Pathway
gtt00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:gtt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GUITHDRAFT_78124
Enzymes [BR:gtt01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     GUITHDRAFT_78124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 17294136
NCBI-ProteinID: XP_005824320
JGI: Guith1_78124
UniProt: L1ING3
Position
Unknown
AA seq 253 aa AA seqDB search
MHEALVCSLQERTVLSRDSYLFRFSLPTDKSFGLPIGQHIRITAEIDGSPVSRSYTPTSK
ESATGHFDLVVKVYRRQDRLRGQMSQYLESLKVGDTIDVFGPKGMFRYNKDGTCNIDGRD
VAVKKFGFICGGSGITPAFQTLQAILDNPQDKTSSWLISANQKEEDILLRAELDRWAQEH
GDRFKCFYTLDSEPLTGWKFGSGYVNEGMIAEHMPAPGPDTIVCLCGPPVMIDDTCIPLL
KKAGFNDEQIFVF
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaagctctcgtctgctctctacaggagaggactgtcctgtcacgagattcctac
ctgttccgattctcgttgcccacagataagagttttggccttcctatcggtcagcacatc
cgaatcactgccgagatagatggctccccagtctcccggagctacacgcctaccagcaaa
gagtctgctacaggacactttgacctggttgtcaaggtctatagaaggcaagacagactg
agaggccaaatgtctcagtatctcgagtctctcaaagttggtgatactattgatgtgttt
gggccaaaagggatgtttcggtataacaaggatggcacttgcaacatcgatggcagagat
gtggccgtgaagaagttcgggttcatctgtggaggcagcggcatcactcccgcgtttcag
accttgcaggctattctcgacaacccgcaagacaagacaagctcctggttgatctccgcg
aaccaaaaggaagaggatattctactccgggcagaacttgacagatgggctcaagagcac
ggcgatcgcttcaagtgcttctacactttggacagtgaacctttgacaggatggaagttt
ggaagcggatacgtgaacgagggtatgatcgccgagcacatgccggcaccagggccggat
acgatcgtgtgcctttgcggacctccggttatgatcgacgacacttgcatcccactcttg
aagaaggccggattcaatgacgagcaaatctttgtattctaa

DBGET integrated database retrieval system