KEGG   Guillardia theta: GUITHDRAFT_79561Help
Entry
GUITHDRAFT_79561  CDS       T02925                                 

Definition
ergosterol biosynthesis ERG4/ERG24 family
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
gtt  Guillardia theta
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gtt00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    GUITHDRAFT_79561
Enzymes [BR:gtt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     GUITHDRAFT_79561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 456 aa AA seqDB search
MKQKSGREQAVWAADNIKPKISGVWDVAGSLFLITAPPISVHLLAYTLLKLDGSWNNLAK
VVSDVGIVQTFSQAVPSSQEVWQAVPFVLCFAAFQLLCMWVVPGKYVDGPVAPSGHVPKY
KANGVQCFLLTILVWAIGSYQGLIPAGWQYDHANAMFAFLNVSSIFLCMLLYLKGRFLPS
TADSGHSGNLIFDFFWGTELYPRFGHWLWPIGWDVKLFTNCRFGMMYWGLSTLSYAAKQY
ELYGFISDSMLVSSLVQVVYVLKFFSWEMGYMNTMDIQHDRAGFYICWGCLVWVPSLYTC
HTLFLVNNPYMMGRAVTAFLLLFGLLGVWINYESDAQKMRFRRSGGKCMIWGRPAKKIVA
TYTTKDGESKQSLLLLSGWWGVSRHFHYIPELMAAFSWTAPTLWKGNWAGFTYWLFLAWL
LTDRSVRDDARCKSKYGESWTKYCELVPYKIIPYIF
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagaagtccggtcgagagcaagctgtgtgggcggcggacaacatcaaacccaag
atctctggggtgtgggatgtggccggatcgctcttccttatcaccgctcccccgatctcc
gtgcatctccttgcctatacgctcctcaagctcgatggctcctggaacaacctggccaag
gtcgtgtcggacgtcggcatcgtgcagaccttctcgcaggcagtcccttcctcccaggag
gtctggcaggccgttcctttcgtgctctgcttcgctgccttccagctgctgtgcatgtgg
gtagttccgggcaagtacgtcgacgggcccgtcgctccttcgggccatgtgcccaagtac
aaggccaacggcgttcaatgcttcctcctcacgatccttgtgtgggcgatcgggtcctat
caagggttgattccagcaggatggcagtacgaccatgccaacgccatgttcgccttcctt
aacgtgtcttccatcttcttgtgtatgctgctgtacctcaagggaaggttcctcccttcc
actgctgacagcgggcactctggaaacttgatcttcgacttcttctggggtacggagctc
tacccgcgcttcggtcactggctgtggccgatcggatgggacgtgaagctctttaccaac
tgcaggttcgggatgatgtactggggcctctctacgctctcctatgctgcgaagcagtac
gagctctacggcttcatcagcgactcgatgctggtgtcgtcgctcgtccaggtagtctac
gtgctcaagttcttctcgtgggagatgggctacatgaacaccatggacatccagcatgac
cgcgctggtttctacatctgctggggctgccttgtgtgggtgccctccctctatacctgc
cacactctctttctcgtcaacaacccctacatgatgggaagagctgtcaccgcgttcctc
ctcctcttcggtctcctcggagtctggatcaactacgagtcagacgcgcagaagatgagg
tttcgcaggagcggagggaagtgtatgatctgggggaggccggcgaagaagattgtggct
acgtacaccaccaaggatggagaaagcaagcagagcttgctgctgctctcgggatggtgg
ggggtcagcaggcactttcattacatccctgagctcatggcggcgttctcctggacggct
ccgacgctgtggaaaggcaactgggccgggttcacctactggctgttcctcgcctggctc
ctgaccgacaggtcagttcgtgatgacgcgcgatgcaagagcaagtacggcgagagctgg
accaagtactgtgagctcgtcccgtacaagatcatcccttacatcttctaa

DBGET integrated database retrieval system