KEGG   Guillardia theta: GUITHDRAFT_85879Help
Entry
GUITHDRAFT_85879  CDS       T02925                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
gtt  Guillardia theta
Brite
Enzymes [BR:gtt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     GUITHDRAFT_85879
Peptidases [BR:gtt01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   GUITHDRAFT_85879
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 362 aa AA seqDB search
MTQGWSTIESDPAVFTSLARDFGIRGTQVEEIVTMEDAEFSNLAPIYGLIFLFKWTQDMA
STHRASSTCVQNHNLYFAKQVIHNACGTQALLNIMMNAEGINLGKELTEFKTFTADFPPD
LKGEAMSNSEMMRSCHNSFARPEPFEMEEDKSRKDGDAYHFTAYMPIGGKLWELDGLQEG
PILLGDCTDTSQWWKQVRPILQDRIEKYSSNEIRFNLLAVCANKKDMYMQELCKLQTDSQ
LISAALLSHGEEVEDMMEDVDTEGYDSKEAPVDVTDKSVEQLKSMLNRFKYRASELRQLL
DMEDEKFQRYARENARRRHNFIPFIMNLLQGLAEKQKLGPLIESAERKAEARKAAAKSSS
KS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagggatggtcgactatcgagagcgaccccgcggtgttcacgtcgcttgcaaga
gacttcgggatacgaggaacccaggtggaggagattgtgactatggaagatgctgagttt
tcaaacttggctccgatctatggtttgatcttcttgttcaagtggacgcaagacatggcg
tcgacgcatcgtgcgagctcgacttgcgttcaaaaccacaacctctacttcgccaagcaa
gtcatccacaacgcctgcggcacgcaagccctgctcaacatcatgatgaacgcggagggc
attaacctgggcaaggagctgacggagttcaagaccttcacggctgacttccctcctgac
ctcaagggcgaggcgatgagcaacagtgagatgatgagaagctgccacaacagcttcgcc
agacccgaaccgtttgaaatggaagaggacaagtcaaggaaagacggagacgcctatcac
ttcacagcttacatgcccatcggtggcaaactctgggagctggatggtctgcaagaggga
ccgatcttgttgggagattgcacagatacttctcagtggtggaaacaggtgcggcccatc
ctgcaggataggatcgagaaatattcctccaacgagatccgctttaatcttttggctgtc
tgcgccaacaagaaggacatgtacatgcaagagctatgcaagctgcagacggactctcag
ctcatcagtgcggcgctcctctctcacggagaggaggtggaagacatgatggaggacgtc
gacacggagggctatgatagcaaggaggcgccagtcgacgtgacggacaagagtgtcgag
cagctgaagagcatgctgaaccgcttcaagtatcgcgcgtcagagctgcgtcagctcctg
gacatggaggatgagaaatttcaacgatacgcgagagagaatgctcgtcgccgacataac
ttcattccttttatcatgaacttgcttcagggtcttgcagagaagcagaagcttggtcct
ctcatcgagtccgcggagcgaaaagcggaagctcgcaaggcagcagccaagagttcttcc
aagtcatga

DBGET integrated database retrieval system