KEGG   Guillardia theta: GUITHDRAFT_96651Help
Entry
GUITHDRAFT_96651  CDS       T02925                                 

Definition
hypothetical protein
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
gtt  Guillardia theta
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gtt00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 538 aa AA seqDB search
MLPLDTVHEEGGKSFLREPEVLRRDLMRLQRAGVQGVMVDVWWGIVERDGPGKYDWSAYM
ELVKMVAELRMKLQAVMSFHQCGGNIGDACFIPLPKWVLEIGDFNPNIFYTDMSLNRNRE
YVSLGADEEKIFYGRSPLDMYEDFMHSFATTFAHFIPNVVIEAQIGLGPAGELRYPSYPL
AFWNFPGVGQFQCYDKYMRRDLIRAAVRAKKPEWGLTWPPHADQVGNYNYSSEHTEFFKD
DGLWQTEAGAFFLEWYSNSLLRHGDKVLARARRAFKSTNILLAAKVAGIHWGSKTKSHAP
ELTAGYFNTCKRDGYKPIAEMFAKHRVMFDFTCLEMKNEDLPDWARSAPVDLVEHTRRAA
DRAGCLYAGENALPRFDRQGFEQIIRQCAHRSGSIASFTYLRLGEHMMDSEHNWLEFVRF
AKEMQIGCNIRTWNAPPRSRQSRRVVDTHVHIPESSLSSIFEFGGTQLYTPAGAPTKTSS
PDALVTGDLPEPRVPRVRPGVQAGTTAGRNGVPNQGKQTIHMLPKVSTPVLTGERFVL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccttggacactgtgcatgaggaagggggaaaaagtttcctcagggagccagag
gtcctgcggcgagacctcatgcggctgcagagagcaggcgtacaaggagttatggtcgac
gtttggtgggggatcgtagagcgagatggaccaggcaagtacgactggtctgcgtacatg
gagctggtgaagatggttgcggagctgcggatgaagctacaggctgtgatgagctttcat
cagtgcggagggaacatcggagacgcctgcttcatccccctgcccaaatgggtgctggag
atcggagacttcaatcccaacatcttttacactgacatgtccctgaaccgcaatcgggag
tacgtctcacttggagcagatgaggagaagatcttctatgggcgatcgcctctggacatg
tacgaggacttcatgcacagcttcgccaccacctttgctcacttcatccccaacgttgtc
atcgaggctcagatcggcctcgggcctgcaggagagttgcgctacccctcctaccccctc
gccttctggaacttccccggcgtcggtcagttccagtgctacgacaagtacatgaggaga
gatctgatcagagcagccgtgcgtgctaagaagcccgagtgggggcttacctggcccccg
catgcggatcaggtcggcaactacaactactcctcggagcatacggaattcttcaaggac
gacgggctgtggcagactgaggccggtgcgttcttcctcgaatggtactccaactcgctg
cttcggcatggggacaaggttcttgcgcgagcaaggagggcgttcaagagcaccaacatc
ctcctggctgccaaggttgcagggatccactggggcagcaagactaagagccatgcgccg
gagctgacggctggatacttcaacacttgcaagcgcgacggctacaaacccatcgctgag
atgtttgcgaagcatcgggtgatgttcgacttcacgtgccttgagatgaagaacgaggac
ctgccggactgggcccgctctgcccctgtcgacctcgtggagcacacgaggagggcggcg
gatcgtgcaggctgcctgtacgcaggagagaacgctctcccccgcttcgaccggcagggc
ttcgagcagatcatcaggcagtgcgcgcatcggagtgggagcatcgcgtctttcacgtac
ctgcggctgggggagcatatgatggactcggagcacaactggctggaattcgtgaggttc
gctaaggagatgcagataggatgcaacatccggacgtggaacgctcctcctcgctcccgc
cagtctcgccgcgtcgtcgacacccacgtccacatccccgagtcctccctctcctccatc
ttcgagttcggagggacgcagctctacactcctgccggtgctcctaccaagacctcctcc
ccggatgcgctcgtcactggcgacctccccgagccccgcgtccctcgcgtcaggcccggt
gttcaggcagggacgacggcaggaaggaacggagtgccaaaccagggcaagcagacgatt
cacatgctgcccaaggtgtcgacacctgtgctgactggagaaaggttcgtgctgtag

DBGET integrated database retrieval system