KEGG   Guillardia theta: GUITHDRAFT_98119Help
Entry
GUITHDRAFT_98119  CDS       T02925                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
gtt  Guillardia theta
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gtt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GUITHDRAFT_98119
Enzymes [BR:gtt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     GUITHDRAFT_98119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 570 aa AA seqDB search
MVTMAAVRTKAWVTSPSMLSSPALLRMPSCSWTGKSSVRGARDSSVQFRGRSARFGAGVR
GMQSAGGWGAGSMEKYDTLVIGSGVSGSSLGFSLFQKGVNVLVTEARDVVGGNVITREQD
GFLWEEGPNTFQPTRQIMRLAVDLGLKDELVFADHTLPRCVYWEKELFPLPSKPEDAPFF
RLLSIPEKIRAGIGAIGLHAPKPDYEESVKDFIERHLGEAVFKKMIDPFVSGVYAGDPTK
LSMASAFKKIYALEDLGMTPSLIEGGIIRQAERAKEARENYDPELPTYKGGALGSFRKGL
VSLPKAAQEKLGDRLRTSWKVESISKGEDGGYVTKFSTPQGSKEVWSKTVAVTAPAHATV
GMLSELVPECKALEEIHYPCVYSVTLAYPKECLKDEVRKERPGLGKRLFGFGNLIPRSMG
IRTLGTIWSSSLFPYRAPEGYEMMLSYIGGAQDPLRYNPPIAELSEEEVAKIVHGDVSKI
LLKEGAPEPKVLGVRKWPKAIPQYNKGYSEIMGKVNSGLSKCPGLYLGGNYVSGVAFGDC
VQWGVDTAPKVKEFLDSVPSSEKAANAALV
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgatggcggcggtgaggacgaaggcttgggtgaccagcccgtccatgctgagc
tctcctgctctcctcaggatgccttcctgctcatggaccggcaagtcctctgtaagaggc
gctagagacagctcggtccagttccggggaaggtcggctcggttcggagctggggttcga
gggatgcaatctgcgggaggatggggagcggggagcatggagaagtacgacacacttgtt
attgggagcggcgtgagcggctcttctcttgggttctccctgttccagaagggcgtcaac
gtccttgttactgaagcaagggacgtggtgggaggaaacgtgatcaccagagagcaggac
gggtttctttgggaggaaggacccaacaccttccagcccactcgccagatcatgcgcctt
gctgtcgatcttggcttgaaggacgagcttgtgtttgctgaccacacccttcctagatgt
gtgtactgggagaaagagctcttccccctcccctccaagcccgaggatgcgccgttcttc
cgcctgctctccatccccgagaagatccgagctggaatcggagcgatcggcctgcatgcg
ccgaagccagactacgaggagtcagtgaaggacttcatcgagcgacaccttggcgaggca
gtgttcaagaagatgatcgaccccttcgtgtcgggagtgtacgcgggtgaccccaccaag
ctctccatggcctcggccttcaagaagatctacgcgctcgaggacctcggcatgacccca
agcttgatcgagggaggcatcatccgccaggcggagagggccaaggaggccagggaaaac
tatgaccctgagctgccaacctacaagggaggggctctcggctccttcaggaagggtctt
gtcagtctccccaaggctgcccaggagaagctcggagatcgcctgaggaccagctggaag
gttgagtccatctccaagggagaggatgggggatacgtcaccaagttttcgaccccccag
ggttccaaggaggtttggtccaagactgtggccgtgactgctcctgctcatgctaccgtg
ggcatgctctccgagcttgtgcctgagtgcaaggcccttgaagagatccactacccgtgc
gtctactccgtcactctcgcctaccccaaggagtgcctcaaggacgaggttcgcaaagag
agaccgggcctcggcaagaggctcttcgggttcggaaacctcatcccccgcagcatgggt
atccgtaccttgggaacgatctggtcctcctcgctcttcccctaccgtgctcccgagggc
tacgagatgatgttgagctacatcggaggagcccaggaccctctccgctacaaccctccc
atcgccgagctctcggaggaagaggtggcaaagattgtccatggtgacgtcagcaagatc
ctcctcaaggaaggagctcctgagccaaaggtcctgggagtgcgcaagtggcccaaggcc
atcccccagtacaacaagggatactcggagattatgggcaaggtcaacagcggtctcagc
aagtgccctgggctgtaccttggaggcaactacgtctctggcgttgccttcggcgactgc
gttcagtggggagtcgacactgcacccaaggtcaaggagttcctcgactccgtcccttcc
tccgagaaggcggccaacgctgcgctggtgtaa

DBGET integrated database retrieval system