KEGG   Guillardia theta: GUITHDRAFT_99389Help
Entry
GUITHDRAFT_99389  CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K11303  histone acetyltransferase 1 [EC:2.3.1.48]
Organism
gtt  Guillardia theta
Brite
Enzymes [BR:gtt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     GUITHDRAFT_99389
Chromosome [BR:gtt03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    GUITHDRAFT_99389
   HAT complexes
    HATB complex
     GUITHDRAFT_99389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hat1_N Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 MOZ_SAS Noggin Acetyltransf_CG
Motif
Other DBs
NCBI-GeneID: 17311771
NCBI-ProteinID: XP_005841716
JGI: Guith1_99389
UniProt: L1K1L9
Position
Unknown
AA seq 495 aa AA seqDB search
MQVPAENVKLCDKEKNKRARFAEKVEESVTIEREEAEDVDDDGESEEEDVPYSCWANEVT
KIKMIVGDDEGSAIEFNPLFTHQVFFNEQPGAEERIHEELIIGYHEPKVVVNYAANTLSS
SVDFKHDGPVDMKQLRQFGLNRTNVLDSVESRMPHDLKDNNIDKVEKDAKAEFTPYGSEI
FNEKLSDTEEVSILHFIADKDEVVPYVKGLQSLAMWCIETAGCIEVPDERWNIFTLYKKV
TKNGSTKFILIGFLTAYKYWVYDRETQKLDKYRMRISQVVVLPPFHRQGYGSKLLNAFYS
FARNDDSILDVSVEDPSEDFQALRDVTDAKTLKEADCLHKLALPNPPIHEMVRRFKICKQ
QMKRLATIAKFVEIKECDPLTDPEKKDTDSLKLRLKVKSSLYKQCKCLAKGKIFIIEPEE
EEEDEDELHRMKAQTKFCQIVESISKSDVQEALELSSHKIWSNGGDPYQRKKQLKQMFAS
LFKQHATVARKILSC
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttccagctgaaaacgtgaagctgtgcgacaaggagaagaataagagagcgaga
ttcgcagagaaggtcgaggagtcggttaccatcgagagagaggaggccgaggacgttgat
gacgatggagagtcagaggaggaggatgttccttactcgtgctgggcgaacgaggtgacg
aagatcaaaatgatcgttggagacgacgaggggtcggcgatcgagttcaatcctttgttc
acgcatcaggtcttcttcaatgagcagccaggagcagaagagagaatacacgaggagctc
attatcggataccacgagcccaaggtcgtggttaattatgctgctaacacactgtcttcg
tctgttgacttcaaacatgatgggcctgttgatatgaaacaattgcggcagtttggcttg
aacaggacaaacgttcttgactctgtcgagtcaagaatgcctcatgacttgaaagacaac
aacattgacaaggttgaaaaggatgcaaaagcagagtttactccctacgggagtgaaatc
ttcaacgagaagctgagtgatacagaggaggtttcgattttgcatttcatcgcagacaaa
gacgaagtggttccgtatgtgaagggattgcagagcttggcaatgtggtgtattgagacg
gcaggatgtattgaagtacccgatgaacgatggaatatcttcaccctgtacaagaaagtt
acaaagaatggaagtacgaaattcatactcatcggatttcttacagcgtacaagtattgg
gtttacgacagagaaacacaaaaactcgacaagtatcggatgcgaatcagccaggtcgtt
gtcctccctccctttcatagacaaggatacgggtcaaagctgctgaatgcattctactcg
tttgcaaggaatgatgacagcattcttgatgtaagcgttgaagacccttcggaagacttc
caggctctccgagatgtaactgacgcaaagacgctcaaggaggcagactgtctgcacaaa
ctcgcgcttccgaaccctccgatccatgagatggttcgaaggttcaagatttgcaaacag
cagatgaaacgactggcaacgatagccaagtttgttgagattaaggagtgcgatcctttg
accgacccagaaaagaaggacactgattccctcaagctaaggctcaaggtcaagtcaagt
ctctacaaacagtgcaagtgcctagccaaaggcaagatcttcatcatcgaacccgaggaa
gaggaagaggacgaggacgagcttcacagaatgaaggcgcagaccaagttttgtcagatt
gttgaaagcatcagtaagtctgatgtgcaagaagctttggaactcagctctcacaagatt
tggagcaacggaggtgatccttaccagagaaagaaacaactcaagcagatgtttgcctca
ttgttcaagcagcatgccacagtagctaggaagatcttgagctgctga

DBGET integrated database retrieval system