KEGG   Guillardia theta: GUITHDRAFT_99389Help
Entry
GUITHDRAFT_99389  CDS       T02925                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
gtt  Guillardia theta
Brite
Enzymes [BR:gtt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     GUITHDRAFT_99389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 495 aa AA seqDB search
MQVPAENVKLCDKEKNKRARFAEKVEESVTIEREEAEDVDDDGESEEEDVPYSCWANEVT
KIKMIVGDDEGSAIEFNPLFTHQVFFNEQPGAEERIHEELIIGYHEPKVVVNYAANTLSS
SVDFKHDGPVDMKQLRQFGLNRTNVLDSVESRMPHDLKDNNIDKVEKDAKAEFTPYGSEI
FNEKLSDTEEVSILHFIADKDEVVPYVKGLQSLAMWCIETAGCIEVPDERWNIFTLYKKV
TKNGSTKFILIGFLTAYKYWVYDRETQKLDKYRMRISQVVVLPPFHRQGYGSKLLNAFYS
FARNDDSILDVSVEDPSEDFQALRDVTDAKTLKEADCLHKLALPNPPIHEMVRRFKICKQ
QMKRLATIAKFVEIKECDPLTDPEKKDTDSLKLRLKVKSSLYKQCKCLAKGKIFIIEPEE
EEEDEDELHRMKAQTKFCQIVESISKSDVQEALELSSHKIWSNGGDPYQRKKQLKQMFAS
LFKQHATVARKILSC
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttccagctgaaaacgtgaagctgtgcgacaaggagaagaataagagagcgaga
ttcgcagagaaggtcgaggagtcggttaccatcgagagagaggaggccgaggacgttgat
gacgatggagagtcagaggaggaggatgttccttactcgtgctgggcgaacgaggtgacg
aagatcaaaatgatcgttggagacgacgaggggtcggcgatcgagttcaatcctttgttc
acgcatcaggtcttcttcaatgagcagccaggagcagaagagagaatacacgaggagctc
attatcggataccacgagcccaaggtcgtggttaattatgctgctaacacactgtcttcg
tctgttgacttcaaacatgatgggcctgttgatatgaaacaattgcggcagtttggcttg
aacaggacaaacgttcttgactctgtcgagtcaagaatgcctcatgacttgaaagacaac
aacattgacaaggttgaaaaggatgcaaaagcagagtttactccctacgggagtgaaatc
ttcaacgagaagctgagtgatacagaggaggtttcgattttgcatttcatcgcagacaaa
gacgaagtggttccgtatgtgaagggattgcagagcttggcaatgtggtgtattgagacg
gcaggatgtattgaagtacccgatgaacgatggaatatcttcaccctgtacaagaaagtt
acaaagaatggaagtacgaaattcatactcatcggatttcttacagcgtacaagtattgg
gtttacgacagagaaacacaaaaactcgacaagtatcggatgcgaatcagccaggtcgtt
gtcctccctccctttcatagacaaggatacgggtcaaagctgctgaatgcattctactcg
tttgcaaggaatgatgacagcattcttgatgtaagcgttgaagacccttcggaagacttc
caggctctccgagatgtaactgacgcaaagacgctcaaggaggcagactgtctgcacaaa
ctcgcgcttccgaaccctccgatccatgagatggttcgaaggttcaagatttgcaaacag
cagatgaaacgactggcaacgatagccaagtttgttgagattaaggagtgcgatcctttg
accgacccagaaaagaaggacactgattccctcaagctaaggctcaaggtcaagtcaagt
ctctacaaacagtgcaagtgcctagccaaaggcaagatcttcatcatcgaacccgaggaa
gaggaagaggacgaggacgagcttcacagaatgaaggcgcagaccaagttttgtcagatt
gttgaaagcatcagtaagtctgatgtgcaagaagctttggaactcagctctcacaagatt
tggagcaacggaggtgatccttaccagagaaagaaacaactcaagcagatgtttgcctca
ttgttcaagcagcatgccacagtagctaggaagatcttgagctgctga

DBGET integrated database retrieval system