KEGG   Geobacter uraniireducens: Gura_0231Help
Entry
Gura_0231         CDS       T00521                                 

Definition
(GenBank) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
gur  Geobacter uraniireducens
Pathway
gur00220  Arginine biosynthesis
gur00250  Alanine, aspartate and glutamate metabolism
gur01100  Metabolic pathways
gur01110  Biosynthesis of secondary metabolites
gur01130  Biosynthesis of antibiotics
gur01230  Biosynthesis of amino acids
Module
gur_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gura_0231
   00220 Arginine biosynthesis
    Gura_0231
Enzymes [BR:gur01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     Gura_0231
Exosome [BR:gur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gura_0231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ASL_C2 SPO22 AbiEi_4
Motif
Other DBs
NCBI-ProteinID: ABQ24447
UniProt: A5GDA7
Position
295857..297233
Genome map
AA seq 458 aa AA seqDB search
MSKDKLWGGRFTQPTDKFVEEFTASIDFDKRLYHQDIRGSIAHARMLGKQKIIPMADVEK
IVQGLQEILAQIEAGTFDFSISLEDIHMNIESRLSAKIGEAGKRLHTGRSRNDQVALDIR
LYLRDELVEISAYLELLIDSLIFQAEKNIDVIMPGYTHLQTAQPILFAHHMLAYVEMFKR
DIGRIEDCLKRANVLPLGAGALAGTTFPIDREHVAELLDFPAVTRNSLDSVSDRDFALEF
LADASILMMHLSRFSEELILWSTSEFKFIELSDGFCTGSSIMPQKKNPDVPELVRGKTGR
VYGNLMALLTVMKSLPLAYNKDMQEDKEPLFDTIDTVKGSLKIFADMIREMRVNVATMRQ
AAAKGFSTATDVADYLVRKGMPFRDAHEVVGKSVAYCIAEKKDLPELSIEEWRSFSDKID
EDIYDAITLEASVNARRATGGTALERVKAEIERAKVGR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggacaaactgtggggtggccgtttcacccagccaaccgataaattcgtcgag
gagttcaccgcttccatcgatttcgacaagcgcctgtatcaccaggatatccgcggctcc
atcgcccatgcccggatgctcggcaaacagaagatcatcccgatggcggacgtggagaag
atagtgcagggactccaggagatcctcgcccagatcgaggcgggaaccttcgatttttcc
atttcccttgaagacatccacatgaacatcgagtcgcgcctctcggccaagatcggcgag
gcgggaaaacggctccataccggccgatcgaggaacgaccaggtggccctggacatccgc
ctctatctgcgggacgagctggtggagatcagcgcctacctggaactcctcatcgattcc
ctgatcttccaggcggaaaagaacatagatgtgatcatgccgggctacacccatctccag
accgcccagccgatcctcttcgcccaccacatgctcgcctacgtggagatgttcaagcgg
gacatcggcaggatcgaggattgtctgaagcgggccaacgtccttccgctcggcgccggc
gccctggccggaaccaccttccccatcgaccgggagcatgtggccgagctgctcgatttt
cccgcggtgacccgcaactccctcgattccgtatcggaccgggatttcgctcttgagttc
ctggccgatgcgtcgatcctcatgatgcacctttcccgcttctccgaggagctgatcctc
tggtcgacgagcgagttcaagttcatcgagctctccgacggcttctgtaccggctcctcc
atcatgccacagaagaagaaccccgatgtcccggaactggtgcgggggaagaccggccgg
gtctacggcaacctgatggcgctcctgacggtgatgaagtcgctcccgctcgcctacaac
aaggacatgcaggaggacaaggagccgctcttcgacaccatcgacacggtcaagggctca
ctcaagatcttcgccgacatgatccgcgagatgcgggtcaatgtggcgaccatgcgccag
gcagcggccaaggggttctccactgccaccgacgtggccgactacctggtacgcaagggg
atgccgtttcgcgacgcccacgaggtggtggggaaatcggtggcctactgcatcgcagag
aagaaagacctgccggaactctccatcgaggagtggcggtccttttccgacaagatcgat
gaggatatctacgacgccatcaccctggaggcgagcgtcaacgcccgccgggccaccggc
ggcacggcgctggaaagggtgaaggcggagatcgaaagggccaaggtcgggagatag

DBGET integrated database retrieval system