KEGG   Geobacter uraniireducens: Gura_0347Help
Entry
Gura_0347         CDS       T00521                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
gur  Geobacter uraniireducens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Gura_0347
Enzymes [BR:gur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Gura_0347
Exosome [BR:gur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gura_0347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(408587..409600)
Genome map
AA seq 337 aa AA seqDB search
MFFPQFRARRIRGKEVFRNMVRETSLSTNDLIYPMFSAFGKGIRKEISSMPGIYQQSIEN
IVAEAQEAYELGVPAVILFGIPEKKDAVGSDAYAEHGIIQETIRALKKDVPKLVVITDVC
MCEYTDHGHCGIIRNGDVDNDETLELLAKEALSHARAGADMVAPSDMMDGRVAAIRESLD
GNGFDHIPVMSYAVKYASGYYGPFREAAESTPQFGDRRSYQMDPANRLEAVREAQMDVEE
GADIIMVKPGLPYLDIVREMRNEFNLPVAVYNVSGEYSMIKAAGKMGWIDEERVIMETMM
SFKRAGADLILTYHAMEVARLLHKGYEAGRAGRCGCP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttctttccccaattcagagcccgccgcatcagaggcaaggaagtgttccgcaacatg
gtccgcgagacctccctctccaccaacgacctgatctacccgatgttttccgccttcggc
aaggggatcaggaaggaaatttcctccatgcccggaatctaccagcagtccatcgagaac
atcgttgccgaggcccaggaagcctacgaactgggcgtaccggcggtgatcctcttcggc
atcccggaaaaaaaggacgcggtggggagcgacgcctacgccgaacacggcatcatccag
gagacgatccgggcgctgaaaaaagatgtgccaaagctggtggtgatcaccgatgtctgc
atgtgcgagtacacggaccacggccactgcggcatcatcagaaacggcgacgtagacaac
gacgagaccctggaactcctggccaaggaggccctttcccatgcccgggccggcgccgac
atggtcgccccttcggacatgatggacggccgggtggcggcgatccgcgaaagcctcgac
ggcaacggtttcgaccatatcccggtaatgagctatgcggtcaagtacgcctcgggctac
tacggcccattccgcgaggcggccgagtccaccccccagttcggcgatcgacgttcctat
cagatggacccggccaaccgcctggaagccgtgcgcgaggcacagatggacgtcgaggaa
ggggcggacatcatcatggtcaagcccggcctcccctacctggacatcgtccgcgagatg
cgcaacgaattcaacctccccgtggcggtctacaacgtttccggcgaatacagcatgatc
aaggcagcaggcaagatggggtggatcgacgaagagcgggtgatcatggagaccatgatg
tccttcaagcgcgccggcgcagacctgatcctcacctaccacgccatggaagtggcgagg
ctcctccacaaggggtacgaggcaggcagagcaggccgctgcggctgtccgtaa

DBGET integrated database retrieval system