KEGG   Geobacter uraniireducens: Gura_0578Help
Entry
Gura_0578         CDS       T00521                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gur  Geobacter uraniireducens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gur00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Gura_0578
Enzymes [BR:gur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Gura_0578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(692778..694583)
Genome map
AA seq 601 aa AA seqDB search
MPVDSLNDIDRHFAAFICRLAGTDDRRLWLAAALVSQAVGSGHVCLDLGSAMASEPATEE
GIGDPAAWGKQLRCWPVIGHPGDFTPLVLDRANRLYLHRYWRYEQQLAAALIRRGAEVPA
AIDEALLKDGVRRLFPAQACGVTDWQRIAALAAVSRRFCVISGGPGTGKTSTVVKVLVLL
LEQAAGEKCRIALAAPTGKAAARLKESILGARGSIDCSDAVRELLPTDVSTLHRLLGFVR
GSSCFRHNRENPLPFDVIVVDEASMVSLPLMAKLVDALADNARLILLGDRDQLASVEAGA
VLGDISNTGAVHGFSRTFCDLAGRISGDPLAAEPYAEEASHRLHDAIVVLRKSYRFAADS
GIGALGNLVNEGNGAAAVALLRGKTFTDIALNGCPPAERLGETLAKSICAGYGPYLKGNG
AGEAHERFGRFRILCALRQGPYGTETVNRLVEAALVREGLINPQGHRWYAGQPVMVTRND
YALQLFNGDIGIILPDPAVDNELRAFFPAADGALRSILPLRLPEHETAYAMTVHKSQGSE
FDRVLLLLPDRQSDVLTRELIYTAITRAKTGVDLWAPDDLLMWAIERRIERKSGLRETLW
G
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttgatagcctgaacgacatagaccgccacttcgccgcgttcatctgccgcctg
gcggggaccgacgaccggcggctgtggcttgccgctgccctcgtcagccaggcggtgggg
agcggtcatgtctgcctcgacctcggctccgccatggcgagtgagccggccacggaggag
gggattggcgatcctgcagcatgggggaaacaactgcgctgctggccggtgatcggccac
cccggcgacttcacccctctcgtcctcgacagggccaaccgcctctatctgcaccgttac
tggcgctatgagcaacaactggccgcggcgctcattcgccggggagcggaagtccccgcc
gccatcgacgaggcgctgctcaaggacggcgtccgacgcctgttcccggcacaagcatgc
ggcgtgaccgactggcagcggatcgcggcactggcagccgtcagccggcgcttctgcgtc
atttcaggaggccccggcacgggaaagacatcgaccgttgtcaaggttctggtcctgctc
ctcgagcaggcggcaggagagaaatgccggatcgcactcgctgcgccgaccggcaaggcg
gcggcacggctcaaggagtcgatcctgggggcgcgaggcagcatcgactgcagcgacgcc
gttcgggaactgctcccgaccgacgtttcgacgctccaccggctcctcggctttgtccgc
ggttcgagctgcttccgccacaaccgggaaaacccgctccccttcgatgtgatcgtcgtc
gatgaagcgtccatggtatcgctcccgctcatggccaaactggtcgatgccctggccgac
aacgcccggctcatccttctcggcgaccgggaccagctcgcctcggtggaagcaggggcg
gtgctgggcgacatcagcaatacaggcgctgttcatggcttttcccgcaccttctgcgat
ctggccgggcggatatccggcgatcccctggcagcagaaccttatgccgaggaggcgtca
caccgtcttcacgatgccatcgtcgtcctgcgcaagagttaccgctttgccgccgacagc
ggcatcggcgccctcggcaacctggtcaatgaagggaacggtgcggcggcagtagcgctc
ctcaggggaaagacgttcaccgacatagccctcaacggatgtccccccgcggaaaggctc
ggcgaaaccctggcgaagagcatctgcgccggctatggaccctacctcaaggggaatggg
gccggcgaggcgcatgagcggttcggtcggttccgcatcctttgcgccctgcgccagggg
ccgtacgggacagagaccgtcaatcgcctggtggaagccgcgcttgtccgggaaggactt
atcaatcctcagggacatcgctggtacgcgggacagccggtcatggtgaccaggaacgac
tatgcgctgcagctcttcaatggcgacatcggcatcatcctgcccgatccggccgtcgat
aacgagctgcgtgcattctttcccgccgctgacggcgcgttgcggtcgatcctgccgctt
cgcctgccggaacacgaaaccgcctatgccatgaccgttcacaaaagccagggttccgaa
ttcgaccgggtgctgctcctcttgccggaccggcagtcggacgttctcacccgcgaactg
atttatacggccattacccgggcaaagacaggggtagatctctgggcgccggacgatctt
ctgatgtgggcaattgagcggcgaattgagcgaaaatccgggcttcgggagacactctgg
ggataa

DBGET integrated database retrieval system