KEGG   Geobacter uraniireducens: Gura_1172Help
Entry
Gura_1172         CDS       T00521                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gur  Geobacter uraniireducens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Gura_1172
   00052 Galactose metabolism
    Gura_1172
   00500 Starch and sucrose metabolism
    Gura_1172
   00520 Amino sugar and nucleotide sugar metabolism
    Gura_1172
Enzymes [BR:gur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Gura_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1382577..1383458
Genome map
AA seq 293 aa AA seqDB search
MQVKKAIFPVAGLGTRFLPATKSTPKEMLPLIDKPLVQYVVEEAVASGIEQILFVTGRSK
RAIEDHFDISFELESLLYDKGKDAELSQIREIADMINIFYVRQKQALGLGHAILCAKEFV
GNEPFAVLLGDDIIDAEKPCLGQLLEVYRKYRGPVLALEQVPMENISSYGCVKANTISER
VFEVVDMVEKPKREEAPSDLAIIGRYILTPDIFPILERQEPGKGGEIQLTDAIKKLANDE
AIYGCRFEGIRHDCGDKLGFLKATVDMALKREEFNGEFEAFLRQRLGVCRTQE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtaaaaaaagcgatattccccgttgccggacttggtacacggtttcttcccgcc
accaaatctactcccaaagagatgcttcccctcatcgacaagcccctggtgcagtacgtt
gttgaagaggcggtggcttccggcatcgagcagattctgttcgtgaccggccgaagcaag
cgggccattgaagatcatttcgacatttccttcgagcttgaatcgctcctctacgataag
gggaaggatgcggaactttcccagatccgtgaaattgccgatatgatcaatatcttctac
gtgcggcagaaacaggctctcggcctcggtcacgccattctctgcgccaaggagtttgtc
ggcaacgagccgtttgccgtcctgctcggcgatgacatcatcgacgcggagaaaccttgc
ctcggccagctgctggaggtttaccggaagtatcgcgggccggtcctcgccctggagcag
gttcccatggagaacatctcttcctatggctgcgtcaaggccaataccatctccgagcgg
gtttttgaagtggtggacatggtggaaaaaccgaagagggaagaggcaccgtcggacctg
gccatcatcggccgttacatcctcacccccgatattttcccgatcctggagcgacaggag
ccggggaaggggggggaaatccagcttaccgacgccattaaaaaactggcaaatgatgag
gccatctacggctgccgctttgaaggcatccgtcacgactgcggcgacaagctgggcttt
ctcaaggccacggtggatatggctctgaagcgggaagagttcaacggcgagttcgaagcg
ttcctgcggcaaaggctaggagtctgtcggactcaggagtga

DBGET integrated database retrieval system