KEGG   Geobacter uraniireducens: Gura_1195Help
Entry
Gura_1195         CDS       T00521                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
gur  Geobacter uraniireducens
Pathway
gur00030  Pentose phosphate pathway
gur01100  Metabolic pathways
gur01120  Microbial metabolism in diverse environments
gur01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Gura_1195
Enzymes [BR:gur01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Gura_1195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ABQ25399
UniProt: A5GAJ1
Position
complement(1408698..1410428)
Genome map
AA seq 576 aa AA seqDB search
MTERILRINMTTLSGAFEEVPAEWQGIGGRALTSAVVAKEVPPTCHPLGKHNKLVFAPGL
LAGSPAAQSGRLSAGAKSPLTGTIKESNAGGTAAQNLAKLRIKALIIEGMPGEDKFYGIQ
INKDGVTIREEAELIGKGNYEAIKTLMGRIGEKVGVLIIGPVGEMRMSAANISVRDPDGN
IRSHGRGGLGAVMGSKKVKYVTIDDSGGPGVEVKDPEKFKNAARAFAKAILEHPVSGEGL
PSFGTNVLVNVLNEAGGLPTKNFRYGQFEGHNKISGETMRDTIIKRGGKPKHGCHAGCII
QCSQVYCDEEGEYVTSGFEYETIWGFGANCCIDDLDIIARADRVMDDIGIDSIESAVIMG
VAMEAGIIPFGDGAGALKLLEEIREGTPLGRILGNGAASVGRAYGLTRVPVVKGQGIPAY
DPRSVKGIGITYATSTQGADHTMGYAVATNILKVGGFIDPLKNEGQVELSRNLQIATAAI
DSTGLCLFVAFPALDIPETMTAIIDMLNAKYGTSLTGDDVIALGKRVLKTEHAFNLAAGF
TSADDRLPEFFNEDPCPPHNVTWTFTGEEIDEFWNF
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaggattttgcgcattaacatgaccaccctttccggcgcgtttgaagaggta
ccggccgaatggcaggggattggcggccgggcactcacctcggccgtcgtggcaaaagag
gtcccccccacctgccatcccctcggcaagcacaacaagctggtctttgcgccggggctc
ctggcggggtcaccggccgcccagtcgggacgcctttcggcaggcgccaagagtccgctg
accggaaccatcaaggagtccaatgccggcggcaccgcagcccagaacctggccaagctg
cgcatcaaggctctcatcatcgaggggatgccgggcgaagacaagttctacggcatccag
atcaataaggacggcgtgacgatccgggaagaagccgaactgatcggcaagggaaactac
gaggccatcaaaaccctgatggggaggatcggcgagaaggtcggcgtcctcattatcggc
ccggtgggggagatgaggatgtccgccgccaatatctcggtccgcgacccggacggcaat
atccgcagccacggccgcggcgggctgggcgcagtaatgggatcgaaaaaggtgaagtat
gtcaccatcgacgacagcggcggaccaggggtggaggtcaaagacccggagaagttcaag
aacgcggcccgcgccttcgccaaggcgatcctcgaacaccccgtgagcggcgaggggctc
ccctctttcggcaccaacgtgctggtcaacgtcctcaacgaagccggcggcctcccgaca
aagaacttccgctacggccagttcgaggggcataacaagatcagcggcgagaccatgcga
gataccatcatcaagcggggcggcaagccgaagcacggctgccacgccggctgcatcatc
cagtgctcccaggtttactgcgacgaggagggggaatatgtcacctccggcttcgaatac
gagaccatctgggggttcggcgccaactgctgcatcgacgacctggacatcatcgcccgg
gccgacagggtcatggacgacatcggcatcgattccatcgagtcggcggtcatcatgggg
gtggccatggaagcgggcatcatccccttcggcgacggcgccggcgccctgaagctcctg
gaggaaatccgcgaggggacccccctcggccgcatcctcggtaacggcgccgcctcggtg
ggaagggcctacggcctgacccgggtgccggtggtcaaggggcagggaatcccggcctac
gacccacgctcggtgaaggggatcggcatcacctacgccacctccacccagggagccgac
cacaccatgggctatgccgtggccaccaacatcctcaaggtaggcggcttcatcgacccg
ctgaagaatgagggccaagtggaactctccaggaacctgcagatcgccaccgcagccatc
gacagcaccggcctctgcctgttcgtcgccttccctgccctggacatcccggagaccatg
acggcgatcatcgacatgctgaacgccaagtacggcacaagcctcaccggcgacgacgtg
atcgccctcggcaaacgggtgctgaaaaccgagcacgccttcaatctggccgccggtttc
accagtgcggacgaccggctcccggaattcttcaatgaagacccctgccccccccacaac
gtcacctggaccttcacaggggaagagatcgacgagttctggaatttctag

DBGET integrated database retrieval system