KEGG   Geobacter uraniireducens: Gura_1261Help
Entry
Gura_1261         CDS       T00521                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gur  Geobacter uraniireducens
Pathway
gur00020  Citrate cycle (TCA cycle)
gur00310  Lysine degradation
gur01100  Metabolic pathways
gur01110  Biosynthesis of secondary metabolites
gur01120  Microbial metabolism in diverse environments
gur01130  Biosynthesis of antibiotics
gur01200  Carbon metabolism
Module
gur_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gur_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gura_1261
  Amino acid metabolism
   00310 Lysine degradation
    Gura_1261
Enzymes [BR:gur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Gura_1261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N GCV_H
Motif
Other DBs
NCBI-ProteinID: ABQ25465
UniProt: A5GAD6
Position
1490917..1492158
Genome map
AA seq 413 aa AA seqDB search
MEIKIPAVGESVFEALVAKWLKTDGELVKKDEPLCEIETDKITLEINAEAAGVLSIRVKA
GETVKIGTVIGAIDEQGVPEGAVAPGVEPAAKPEFQPVTPQPPLSPAVRKMAQEKGLKPE
TILGSGKGGRITVDDLLKAGIGDLGTGIGDREKLPMAGPVVEQPSLFGPAAEPLPTQAGE
EGRITRKPMTPIRKRIAERLLAVRQQTAMLTTFNEADMGRIIALRKNHNERFMLRHGVAL
GFMPFFVKACIDALKAFPIVNARIDGDDIVYQHFYDIGIAIGGEKGLVVPIIRDADRRNL
AEIEKAIQVYVERVKINQLNLADITGGTFTISNGGVYGSMLSTPIINPPQSGVLGMHAIQ
ERPVALDGKVVIRPMMYLALSYDHRIIDGREAVGFLKKIKECIEDPEEMLLEG
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggaaataaaaataccggcggtcggcgaatccgtgttcgaggcgctcgtcgccaagtgg
ctcaaaacggacggcgaactggtaaagaaggacgagccgctctgcgagatcgagaccgac
aagatcaccctggagatcaatgcggaggcggccggcgttctttccatcagggtgaaggcc
ggggaaacggtcaagatcggcacggtgatcggcgccatcgatgaacagggagtgccggaa
ggtgcggtagcccccggcgtggaacctgctgccaaacccgaattccagccggtgacgccg
cagccgcccctttcgccggcggtgcgcaagatggcccaggaaaaggggctaaaaccggaa
acgatcctggggagcggcaagggggggcggataacggtggatgacctgttaaaggctggg
atcggggatctgggaacggggatcggggatcgggaaaagctgccaatggccggtcccgtc
gttgagcagccttctctctttgggcctgctgcagagcctcttcccacccaagccggcgaa
gagggacggataacccgcaagccgatgaccccgatccgtaaaaggattgcagagcggctt
ctggcagtgcggcagcagaccgccatgctcactaccttcaacgaagcggacatgggaagg
atcattgccctgcgcaagaaccacaacgagcgcttcatgctccggcacggcgtggcgctc
gggttcatgccgttcttcgtcaaggcctgcatcgacgcgctcaaggcgtttcccatagtc
aatgcccgtatcgacggtgatgatatcgtctaccagcatttttacgacatcggcatcgcc
atcggcggggagaaggggttggtggtgccgatcatccgcgatgcggaccggcgcaatctt
gcggagatcgaaaaggccatccaggtctatgtggagcgggtcaagatcaatcagctcaac
cttgcggacattaccggcgggactttcaccatcagcaacggcggggtttacggctcaatg
ctcagcacgccgatcatcaacccgccccagagcggggttctcggcatgcatgccatccag
gagaggccggtggccttggacggcaaggtggtgattcggccgatgatgtacctggccctc
tcctacgaccaccggatcatcgacggccgcgaggcggtggggtttctcaaaaagatcaaa
gagtgtatcgaagacccggaggagatgctgttggaggggtaa

DBGET integrated database retrieval system