KEGG   Geobacter uraniireducens: Gura_1316Help
Entry
Gura_1316         CDS       T00521                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
gur  Geobacter uraniireducens
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1553192..1554232
Genome map
AA seq 346 aa AA seqDB search
MKWKISCGIMVLMLAGGVAWGKDDIMSQARAIFKPVPAKPPVLKENPSTPAKIELGKMLF
FDPRLSSSNLISCNTCHNVGLGGVDIQETSVGHGWQKGPRNAPTVLNAVFNLAQFWDGRA
KDLEAQAKGPVQASVEMNNKPERVLETLNSIPGYLPLFKKAFPRDKDPITFDNMARAIEV
FEATLITPDSRFDRFLKGDRKVLAAKEQEGLRLFMDKGCSACHNGVNIGGTGYFPFGVKE
SPAADVRPTEDLGRFKVTNTAADKYVFKSPSLRNIELTPPYFHSGKVWKLGDAVEIMGAA
QLGITLNDDEAGKIVAFLKTLNGKQPKVVYPIMPPNSDATPKPMLQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggaaaatttcgtgtggcatcatggtgttaatgcttgcgggaggcgttgcctgg
ggaaaggacgacataatgagccaggcccgggcaatcttcaagcctgtgccggcaaagcct
ccggttctaaaggagaacccgtccactccggccaaaatagagctggggaaaatgctcttt
tttgacccgcgactatcgtcatcaaacctgatcagttgcaatacctgccataacgtcggg
ctcggcggggtagacatccaggagacatccgtcggtcacggttggcagaaaggcccgcgt
aacgctccgacggtgttgaacgccgtgttcaaccttgcccagttctgggacggtagggca
aaagatcttgaggcccaggccaagggaccggttcaggcatcggtggagatgaacaacaaa
ccggagcgggtgctggaaaccctcaatagtattccaggctatctgccgctattcaaaaaa
gcatttccccgcgacaaggatccgataacctttgacaatatggcccgtgccatcgaggtg
ttcgaggctacgctcatcacgccggattcccgctttgaccgctttctcaaaggagaccgg
aaagtgcttgcagccaaagagcaagaagggttgaggcttttcatggacaaggggtgctct
gcctgtcacaacggtgtcaatatcggcggtaccggatacttccccttcggagtcaaagag
agccctgccgccgatgtccgacccacggaagacctcgggcgcttcaaggttaccaatacg
gctgcggacaaatatgtcttcaagtctccatcgctccgcaacattgaactgacgccgccc
tacttccactccggcaaggtatggaaactgggcgatgcggtagagatcatgggggctgcg
cagctcggcatcactctcaacgatgatgaagccggtaaaatcgtggcgtttctcaagacc
cttaacggcaagcagccgaaagtcgtttatccgatcatgccgcccaattccgatgccacg
ccgaaaccaatgctgcagtag

DBGET integrated database retrieval system