KEGG   Geobacter uraniireducens: Gura_1608Help
Entry
Gura_1608         CDS       T00521                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gur  Geobacter uraniireducens
Pathway
gur00010  Glycolysis / Gluconeogenesis
gur00620  Pyruvate metabolism
gur00640  Propanoate metabolism
gur00680  Methane metabolism
gur01100  Metabolic pathways
gur01110  Biosynthesis of secondary metabolites
gur01120  Microbial metabolism in diverse environments
gur01130  Biosynthesis of antibiotics
gur01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gura_1608
   00620 Pyruvate metabolism
    Gura_1608
   00640 Propanoate metabolism
    Gura_1608
  Energy metabolism
   00680 Methane metabolism
    Gura_1608
Enzymes [BR:gur01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Gura_1608
Lipid biosynthesis proteins [BR:gur01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Gura_1608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABQ25804
UniProt: A5GEE9
Position
1871163..1872917
Genome map
AA seq 584 aa AA seqDB search
MDWKPIRKSPELQAVRPHLLDYEKTCAGFSWEAVRSELSGLPEGKGLNIAHEAVDRQAAG
PLRDRLAFRWLGKDGAVQDFTFCDLKEQSSRFANVLKRLGVEKGERVFVLAGRIPPLYIA
ALGCLKNISVFCPLFSAFGPDPIRQRLSRGDARLLVTTERQYAKKIAGIRESLPQLRHVL
LTDIDDDLDETVLSLPRLMAEASADFTIPPTDPEDMAVLHFTSGTTGMPKGAVLVHDAVL
THLVTGRYVMDFHSADIFWCTADPGWVTGSSYGIIAPLLHGITSIIDEADFDAERWYRIL
EEQRVTVWYTAPTAIRMLMRAAIEPLKRFDLSPLRLIHSVGEPLNPEAVVWGERVLGLPI
HDNWWQTETGGIMIANYAAMEIRPGSMGRPLPGIEAAIVRRVDDSVDVLTEPDVEGDLAL
RPGWPSMFRAYLHDEERYRKCFVSGWYITGDLAKRDADGYYWFVGRGDDIIKTSGHMVGP
FEVESALMEHPAVAEAGVIGKPEPIIGEIVKAFVCLKPGFEPTDKLRLELIGFGRTRLGS
AVAPKEMEFVDSLPRTRSGKIMRRLLKARELGLPEGDTSTLETG
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
gtggattggaaaccgataaggaaatcgccggaattgcaggctgttcggccgcatcttctc
gattacgaaaagacctgcgccggcttttcctgggaggctgtccgcagtgagctttccggt
ttaccggaagggaaggggctcaacattgcccacgaggccgtcgaccgtcaggcagccggt
cccctgcgcgacaggcttgccttccgctggctggggaaagatggggcggtgcaggacttc
actttctgtgatcttaaggagcagagcagccgctttgccaatgttctcaaacgattggga
gtggagaagggggagcgggtcttcgtccttgccggccgcatccccccgctctacatcgcc
gccttgggctgcctgaaaaacatcagcgttttctgcccgctcttttccgcctttgggcct
gacccgatccggcagcgcctctccaggggggatgcccggctcctggtgaccaccgagcgg
cagtatgcgaaaaagatcgccggcatcagggagagcctgccgcagctccgccatgtactc
ctgaccgatatcgacgatgatctggacgagacggtcttgtcgctgccgcggctgatggcg
gaggcctccgccgatttcacgatcccgcctaccgacccggaagatatggcggtccttcac
ttcacgagcggcaccaccggcatgccgaagggggcggtgctcgtacatgacgctgtcctc
acccacctcgtcaccggccgctatgtcatggacttccattcggccgacatcttctggtgc
accgccgatcccggctgggtgaccggcagttcctacggaatcatcgctcctctcctccat
ggcatcaccagcataatcgacgaggcggatttcgatgcggagcgctggtacaggatcctt
gaagagcaacgggtgacggtctggtacacagcccccaccgccatacgaatgctgatgcgc
gccgccatcgaaccactcaagcgattcgatctctcacctttgcgcctcatccatagtgtc
ggcgagcctctcaatcccgaggcggtggtctggggagagcgtgtcctcggcctccccatt
cacgacaactggtggcaaaccgaaaccggcggcattatgatcgccaactacgccgcaatg
gagatccgtcccggctccatggggcgtcccctgccggggattgaagcggctatcgttcgg
cgggtcgacgatagtgttgatgttttgacggagccggacgtggagggggatctggcgctc
aggcccggctggccgtcgatgttccgtgcctatctccacgatgaagagcgttacaggaaa
tgcttcgtgagcggctggtacatcaccggcgacctggcgaagcgcgatgcagacggctat
tactggtttgtcggccgtggtgacgacatcatcaagacctccgggcacatggtcgggccg
ttcgaggtggaaagcgcgctcatggagcacccggcggtagctgaggcaggggtgatcggc
aagcccgagccgattatcggcgagatcgtcaaggcctttgtctgcctgaagcccggcttc
gagcccaccgacaagctccgcctggagcttatcggtttcggccggaccaggctcggctcg
gcggtggcgcccaaggagatggaattcgtcgattccctgccaaggaccaggagcggcaag
atcatgcgcaggcttttaaaggcgcgggaactgggactgccggagggggacacttctacc
ctggagacggggtga

DBGET integrated database retrieval system