KEGG   Geobacter uraniireducens: Gura_1803Help
Entry
Gura_1803         CDS       T00521                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
gur  Geobacter uraniireducens
Brite
Enzymes [BR:gur01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Gura_1803
Secretion system [BR:gur02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Gura_1803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2089186..2089968
Genome map
AA seq 260 aa AA seqDB search
MYRVMVLTGLMLGLSAGSALAMAKEGCGGECVSCHSLSEKEAGTLLKGLGTVKSVKPSPV
RGLYELRLEKDGTQAIAYVDYGKKNIIAGQIFDIASRQLVTTKITASPIKAEKIDVGKIP
LDNSLVMGNANGTKKLFVFTDPDCPYCANMHAELKKLVEMDKDIAVYVKLFPLEMHPKAY
DKSRLILSENSLNLLDTAFSGGKLPEPLAKHSGKGVDETKAFARSVGISSTPTLVLPDGR
ILPGFRDALAVMRSVNGETQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtatagagtaatggtgcttacaggactgatgttggggctctcggccggcagtgcactc
gccatggcaaaggaagggtgcggtggcgagtgcgtctcgtgccattcgctcagcgaaaaa
gaagctggtacgctgttaaagggattggggacggtaaaatccgtcaagccgtcaccggtg
cgaggactctatgaactacgtctggagaaggacggtacccaggcaatcgcctatgttgat
tatgggaagaaaaacatcattgccgggcagatattcgatatcgcctcccgccagctggtt
accacaaaaattacagcgtcgccaataaaagcagagaagatagatgtcggcaaaattccc
ctggacaattccctggtcatgggtaacgcgaatggaactaagaagcttttcgtctttacc
gacccggattgcccctactgtgcaaacatgcacgctgaactgaaaaagctggtggagatg
gacaaagatatcgcggtttatgtcaagctcttcccgttggagatgcacccgaaggcctac
gacaagtcacggctgattctgtctgaaaactccctgaatcttctggatacggccttttcc
ggcggcaagttgcctgaacctctggcaaagcattcaggaaagggtgttgatgaaaccaag
gcttttgccaggtctgtcggcatcagttctacgccgaccctggtactgccggacgggcgg
atactgccggggttcagggatgccttagcggtaatgagatcggttaacggtgaaacacag
taa

DBGET integrated database retrieval system