KEGG   Geobacter uraniireducens: Gura_1892Help
Entry
Gura_1892         CDS       T00521                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gur  Geobacter uraniireducens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Gura_1892
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gura_1892
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Gura_1892
Enzymes [BR:gur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Gura_1892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2195535..2196917)
Genome map
AA seq 460 aa AA seqDB search
MKYISTRGNIQPVGFKEAVMMGLATDGGLLLPERIPAIDAATLSSWRQLPYRELAFRIIS
LFADDIPANDLKRLIDSSYDSFDHKEITPVVKENGVYIAELFHGPTLAFKDVALQFLGNL
FEYLLKESGQKMNIVGATSGDTGSAAIYGVRGKENINIFILHPHGKTSPIQARQMTTVLD
ANVHNIAVKGTFDDCQNIVKELFNDLTFKEKYALGAVNSINWARVLAQVVYYFYAWFRVS
DEVDSPITFSVPTGNFGDIFAGFVAKRMGLPIDKLLLATNENNILTRFINEGDYSIGSVV
QTVSPSMDIQVASNFERYLYYLFDENPARVRDIFTRFAATGRMDFTDEEMRTVRREFASR
SVNEQETLDTIAAFHQETGYLLDPHTAVGVKAALACVTDGTAVCLATAHPAKFGEAVEKA
TGTAPPFPACLAGIEQLPTRCEIMEANRTAIEKFIAEKAR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatcagcaccagaggcaacatccagccggtcggctttaaggaagcagtgatg
atgggactggccaccgacggcggcctgctcctccccgagcgaattccggccatagacgcc
gcaaccctttcttcatggcgccaactcccctaccgtgagctggcattccggatcatttcc
ctgtttgccgacgacattccggcaaacgacctgaaacgcctcatcgacagctcctacgac
agctttgaccacaaagagatcactccggtggtgaaggaaaacggggtttacattgcagag
cttttccacggcccgactctggcattcaaggatgtcgcgctgcagtttttagggaacctt
ttcgaatacctgctcaaggagagcgggcaaaaaatgaacatagtcggcgcgacctcgggc
gacacggggagcgctgccatttacggggtacgcggcaaggaaaacatcaacatcttcatt
cttcacccccatggcaagacttcacccatccaggcgcgccagatgaccaccgtgcttgac
gccaatgtgcacaacatagcggtcaaaggaacctttgacgattgccagaacatcgtcaag
gaactgttcaacgaccttaccttcaaggaaaagtacgcacttggagcggtaaactccata
aactgggcacgggttctggcgcaggtagtttattatttctacgcctggttcagggtcagc
gatgaagtggattcccccattaccttctccgtgccgaccggcaacttcggcgatattttt
gccggttttgtggcaaaacgcatgggacttcccatcgataaactgctcctggctaccaat
gaaaacaacatcctcacccgctttatcaacgagggggactactcaataggctccgtggtg
cagaccgtttctccttccatggatattcaggtcgcctccaatttcgaacgctacctctat
tacctgttcgacgaaaacccggcgagggtccgcgacatatttacccgctttgccgcaacc
ggccgcatggatttcacggatgaggagatgagaacggtacggcgagagttcgcctcccgc
tcggtcaacgaacaggaaaccctggatacgattgccgcttttcaccaagaaaccggctat
ctcctggacccgcacacggcagtgggcgtcaaggccgcactggcgtgcgttacggacggc
acagccgtctgtctggccacggcgcatccggccaagttcggtgaagccgtggaaaaggct
accggtaccgctccgccattcccggcgtgcctggcaggaatcgaacaactgccgacacgc
tgcgagatcatggaggcaaatcggacggcaatcgagaaattcatagcggaaaaggcccga
taa

DBGET integrated database retrieval system