KEGG   Geobacter uraniireducens: Gura_2059Help
Entry
Gura_2059         CDS       T00521                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gur  Geobacter uraniireducens
Pathway
gur00010  Glycolysis / Gluconeogenesis
gur00051  Fructose and mannose metabolism
gur00562  Inositol phosphate metabolism
gur01100  Metabolic pathways
gur01110  Biosynthesis of secondary metabolites
gur01120  Microbial metabolism in diverse environments
gur01130  Biosynthesis of antibiotics
gur01200  Carbon metabolism
gur01230  Biosynthesis of amino acids
Module
gur_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gura_2059
   00051 Fructose and mannose metabolism
    Gura_2059
   00562 Inositol phosphate metabolism
    Gura_2059
Enzymes [BR:gur01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Gura_2059
Exosome [BR:gur04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Gura_2059
  Exosomal proteins of bladder cancer cells
   Gura_2059
  Exosomal proteins of melanoma cells
   Gura_2059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABQ26249
UniProt: A5G381
Position
complement(2409639..2410394)
Genome map
AA seq 251 aa AA seqDB search
MRKPVIAGNWKLYKTTSEALELVNELIPLVKNASGVEIVVAPVFTVLSTVKNALKGTNIN
LAAQDCFWDEQGAYTGEVSSTMLLDAGCSHVIIGHSERRQFFGETDETVNKKNIAALRAG
LTILFCIGETLHEREENQTFTVLERQISGGISGITKDELKNVIIAYEPVWAIGTGKTATD
DQAQEAHKFIRGVVAKLCDSESAENIRILYGGSVKPENVKGLMAQKDIDGALVGGASLKA
DSFAHIVRFSE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccagtaatcgccggcaattggaaactttataagaccacaagcgaagcgctc
gagctagtcaatgaacttatccccctggtcaaaaatgcttccggggttgaaattgtcgta
gctccggtatttaccgtattaagtacggtaaagaacgctttaaagggaacgaatatcaac
ctggctgcccaagactgtttttgggatgaacaaggtgcgtatactggtgaagtttccagt
acaatgctgcttgatgccggatgcagtcatgtaattatcgggcattcagaacgaagacag
ttctttggagaaaccgatgagaccgtaaataaaaaaaatatagcagcgttgcgtgccgga
ctgaccatacttttctgcatcggagaaactcttcacgagcgtgaagaaaaccaaaccttc
acggtccttgaacggcagattagcggcggtatttcagggattacgaaggatgaactgaaa
aatgtgatcattgcttatgagcctgtatgggcgatcggcacgggcaaaactgcaactgac
gatcaagcacaggaagctcacaaatttatccggggagttgtggcaaagctatgcgacagc
gagtctgcagaaaatatcaggattctctacggaggaagtgtgaaacctgagaacgtcaaa
ggactcatggcccaaaaggatatcgatggtgccctggttggcggcgcaagccttaaagct
gattcttttgcacatatagtccgctttagtgaataa

DBGET integrated database retrieval system