KEGG   Geobacter uraniireducens: Gura_2059Help
Entry
Gura_2059         CDS       T00521                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gur  Geobacter uraniireducens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gura_2059 (tpiA)
   01230 Biosynthesis of amino acids
    Gura_2059 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gura_2059 (tpiA)
   00051 Fructose and mannose metabolism
    Gura_2059 (tpiA)
   00562 Inositol phosphate metabolism
    Gura_2059 (tpiA)
Enzymes [BR:gur01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Gura_2059 (tpiA)
Exosome [BR:gur04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Gura_2059 (tpiA)
  Exosomal proteins of bladder cancer cells
   Gura_2059 (tpiA)
  Exosomal proteins of melanoma cells
   Gura_2059 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2409639..2410394)
Genome map
AA seq 251 aa AA seqDB search
MRKPVIAGNWKLYKTTSEALELVNELIPLVKNASGVEIVVAPVFTVLSTVKNALKGTNIN
LAAQDCFWDEQGAYTGEVSSTMLLDAGCSHVIIGHSERRQFFGETDETVNKKNIAALRAG
LTILFCIGETLHEREENQTFTVLERQISGGISGITKDELKNVIIAYEPVWAIGTGKTATD
DQAQEAHKFIRGVVAKLCDSESAENIRILYGGSVKPENVKGLMAQKDIDGALVGGASLKA
DSFAHIVRFSE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccagtaatcgccggcaattggaaactttataagaccacaagcgaagcgctc
gagctagtcaatgaacttatccccctggtcaaaaatgcttccggggttgaaattgtcgta
gctccggtatttaccgtattaagtacggtaaagaacgctttaaagggaacgaatatcaac
ctggctgcccaagactgtttttgggatgaacaaggtgcgtatactggtgaagtttccagt
acaatgctgcttgatgccggatgcagtcatgtaattatcgggcattcagaacgaagacag
ttctttggagaaaccgatgagaccgtaaataaaaaaaatatagcagcgttgcgtgccgga
ctgaccatacttttctgcatcggagaaactcttcacgagcgtgaagaaaaccaaaccttc
acggtccttgaacggcagattagcggcggtatttcagggattacgaaggatgaactgaaa
aatgtgatcattgcttatgagcctgtatgggcgatcggcacgggcaaaactgcaactgac
gatcaagcacaggaagctcacaaatttatccggggagttgtggcaaagctatgcgacagc
gagtctgcagaaaatatcaggattctctacggaggaagtgtgaaacctgagaacgtcaaa
ggactcatggcccaaaaggatatcgatggtgccctggttggcggcgcaagccttaaagct
gattcttttgcacatatagtccgctttagtgaataa

DBGET integrated database retrieval system