KEGG   Geobacter uraniireducens: Gura_2075Help
Entry
Gura_2075         CDS       T00521                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gur  Geobacter uraniireducens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gura_2075
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gura_2075
   00052 Galactose metabolism
    Gura_2075
   00500 Starch and sucrose metabolism
    Gura_2075
   00520 Amino sugar and nucleotide sugar metabolism
    Gura_2075
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Gura_2075
   00524 Butirosin and neomycin biosynthesis
    Gura_2075
Enzymes [BR:gur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Gura_2075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2431824..2432810
Genome map
AA seq 328 aa AA seqDB search
MMSGSAEKICIGIDVGGTNLRFALVDELGKVLFRERRSTEIHQGKEQFLKRFFSVIASLR
TWADSSGKEIVAIGAGVPGLISNDGIIYSSVNLLPLEGLNLRELITAAAGLPAIVVNDAN
ASAWGEKCYGAGRSMNSFLMLTLGTGVGSGLVLNDKLWTGCDGVAGEFGHVTVEPDGKPC
PCGNHGCLEQYASATALVAEAGEAIQAGGGGALANVPASMLNAEVLADAAHGGDALAKAI
FENAGRYLGIASAAAVNLLNLEGIILGGGVAASYDLIVEPMRREILARAFAIPARRVRLV
RAELEDDAGILGAAAMALASVKSDLSNE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgggttctgccgagaaaatctgcatcggcatcgatgtcggggggacaaatctc
agatttgccctggtagacgaactgggtaaggttttattcagggaacgtcgatcgacagaa
attcaccaaggaaaagaacagtttctcaaacggtttttctcggttatcgcgtcattaaga
acctgggctgactcttccggcaaagagatcgttgccataggtgcaggtgtgccgggactc
atctccaatgatgggatcatttattcatcggtgaatcttctgccgctggagggacttaat
cttcgcgaattaataactgccgccgccggtttgccggccattgtagtcaatgacgccaat
gcttcggcatggggcgaaaagtgttatggcgcaggcaggtcgatgaactcttttctcatg
ctcaccttgggcacgggtgtcggtagcggccttgtacttaatgacaaactttggaccggt
tgcgatggggtggcaggagagtttggtcacgttacagttgaacccgatggtaaaccttgc
ccatgcggcaaccacggctgccttgaacaatacgcctctgcaacggcccttgttgcagag
gctggcgaggccatccaggctgggggagggggagcgcttgccaatgttccagcttctatg
ctcaatgccgaagttcttgccgatgctgcccatggtggtgatgcgctcgccaaggccatc
ttcgagaatgccggacgctatttgggaattgcctctgctgctgcggtaaacctcctgaat
ctggagggcataattttgggaggcggagtggctgcaagttacgacctcatcgtcgaacct
atgcggcgtgaaattcttgcccgtgcatttgccattccggcccggagagtccgtctcgtc
agggcggaattggaagacgatgcgggcattctcggtgctgccgcaatggcgctggccagc
gttaagtctgacttatcaaatgaatga

DBGET integrated database retrieval system