KEGG   Geobacter uraniireducens: Gura_2075Help
Entry
Gura_2075         CDS       T00521                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gur  Geobacter uraniireducens
Pathway
gur00010  Glycolysis / Gluconeogenesis
gur00052  Galactose metabolism
gur00500  Starch and sucrose metabolism
gur00520  Amino sugar and nucleotide sugar metabolism
gur00521  Streptomycin biosynthesis
gur01100  Metabolic pathways
gur01110  Biosynthesis of secondary metabolites
gur01120  Microbial metabolism in diverse environments
gur01130  Biosynthesis of antibiotics
gur01200  Carbon metabolism
Module
gur_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gura_2075
   00052 Galactose metabolism
    Gura_2075
   00500 Starch and sucrose metabolism
    Gura_2075
   00520 Amino sugar and nucleotide sugar metabolism
    Gura_2075
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Gura_2075
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Gura_2075
Enzymes [BR:gur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Gura_2075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FGGY_N BcrAD_BadFG DGOK Hexokinase_1
Motif
Other DBs
NCBI-ProteinID: ABQ26265
UniProt: A5G397
Position
2431824..2432810
Genome map
AA seq 328 aa AA seqDB search
MMSGSAEKICIGIDVGGTNLRFALVDELGKVLFRERRSTEIHQGKEQFLKRFFSVIASLR
TWADSSGKEIVAIGAGVPGLISNDGIIYSSVNLLPLEGLNLRELITAAAGLPAIVVNDAN
ASAWGEKCYGAGRSMNSFLMLTLGTGVGSGLVLNDKLWTGCDGVAGEFGHVTVEPDGKPC
PCGNHGCLEQYASATALVAEAGEAIQAGGGGALANVPASMLNAEVLADAAHGGDALAKAI
FENAGRYLGIASAAAVNLLNLEGIILGGGVAASYDLIVEPMRREILARAFAIPARRVRLV
RAELEDDAGILGAAAMALASVKSDLSNE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgggttctgccgagaaaatctgcatcggcatcgatgtcggggggacaaatctc
agatttgccctggtagacgaactgggtaaggttttattcagggaacgtcgatcgacagaa
attcaccaaggaaaagaacagtttctcaaacggtttttctcggttatcgcgtcattaaga
acctgggctgactcttccggcaaagagatcgttgccataggtgcaggtgtgccgggactc
atctccaatgatgggatcatttattcatcggtgaatcttctgccgctggagggacttaat
cttcgcgaattaataactgccgccgccggtttgccggccattgtagtcaatgacgccaat
gcttcggcatggggcgaaaagtgttatggcgcaggcaggtcgatgaactcttttctcatg
ctcaccttgggcacgggtgtcggtagcggccttgtacttaatgacaaactttggaccggt
tgcgatggggtggcaggagagtttggtcacgttacagttgaacccgatggtaaaccttgc
ccatgcggcaaccacggctgccttgaacaatacgcctctgcaacggcccttgttgcagag
gctggcgaggccatccaggctgggggagggggagcgcttgccaatgttccagcttctatg
ctcaatgccgaagttcttgccgatgctgcccatggtggtgatgcgctcgccaaggccatc
ttcgagaatgccggacgctatttgggaattgcctctgctgctgcggtaaacctcctgaat
ctggagggcataattttgggaggcggagtggctgcaagttacgacctcatcgtcgaacct
atgcggcgtgaaattcttgcccgtgcatttgccattccggcccggagagtccgtctcgtc
agggcggaattggaagacgatgcgggcattctcggtgctgccgcaatggcgctggccagc
gttaagtctgacttatcaaatgaatga

DBGET integrated database retrieval system