KEGG   Geobacter uraniireducens: Gura_2076Help
Entry
Gura_2076         CDS       T00521                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gur  Geobacter uraniireducens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:gur01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:gur01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gur00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:gur00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:gur00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gur00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:gur00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2432835..2433923
Genome map
AA seq 362 aa AA seqDB search
MKKRIGILTGGGDCPGLNAVIRGVVTAAIIKYDWEVVGVEDGFDGLLNSEKCRQLSLEDV
RGILPRGGTILGTTNRGNPFSYPVEKNGKIEYIDISESVIDRIKAMGIDALVVVGGDGSL
KIAMELMSKGVPIVGVPKTIDNDLMETDVTFGYNTALETATDALDKLHSTAESHHRVMIM
EVMGRYAGWIALESGIAGGADVILIPEIPFDIKKICHAIDERRKKGSRFSIIVAAEGAFP
DGGKRVVKQNADSAHSIERLGGVGEYIAGELSGCLDMDVRVTVLGHLQRGGSPSTFDRCL
GSRFGVKALELIAKNEFGRMVCLNGRSIKSVSIEKAVRKLKLVDPDGEMVKCAEELGIML
GR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtatcggcatacttaccggtggtggcgattgccctggactcaacgcggtt
atcaggggcgtggtaacggctgccatcataaaatatgattgggaggttgttggggttgaa
gacggattcgatggccttttgaacagtgaaaagtgtcgtcaactttcactggaagatgtg
cgcggcattcttccccgcggagggaccatactcggtacaacaaaccggggaaatcccttc
tcatatcctgtcgaaaaaaatggtaaaatcgaatatattgatatttccgagagcgttatt
gaccgtatcaaggctatgggtatcgatgcccttgtggttgtaggtggtgacggctcattg
aagatcgccatggaactgatgagcaagggggttcccattgtcggcgtaccgaaaactatc
gataacgatcttatggaaaccgatgtgaccttcggctataacacagccctggaaactgcc
accgatgccctcgacaagctgcattcaaccgcggaaagtcatcatcgtgtcatgataatg
gaggtgatggggagatatgccggttggatagccctggaatcgggaattgccggtggtgcc
gatgtcattcttatcccggaaatcccattcgacattaaaaaaatctgtcatgccattgat
gagagacgcaaaaaggggagccggttcagcattatagttgcagctgaaggtgctttccct
gatggaggtaaacgggtcgtaaagcagaatgccgactctgcccattccattgagcgcctg
ggaggagtcggtgagtatatcgccggggaactttcaggctgtctcgacatggacgtcagg
gtgacggtactgggtcacctgcagcgcggcggttcgccatcgactttcgatcgctgcctc
ggtagccgctttggggtcaaggcccttgaactcattgctaaaaacgaattcggcaggatg
gtctgcctgaatggacgaagcatcaaatcggtttccatagaaaaggctgtaaggaaactc
aaactggtcgatccggacggtgagatggtaaaatgcgccgaagagttggggataatgctc
ggcagataa

DBGET integrated database retrieval system