KEGG   Geobacter uraniireducens: Gura_2076Help
Entry
Gura_2076         CDS       T00521                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gur  Geobacter uraniireducens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gura_2076
   01230 Biosynthesis of amino acids
    Gura_2076
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gura_2076
   00030 Pentose phosphate pathway
    Gura_2076
   00051 Fructose and mannose metabolism
    Gura_2076
   00052 Galactose metabolism
    Gura_2076
  Energy metabolism
   00680 Methane metabolism
    Gura_2076
Enzymes [BR:gur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Gura_2076
Protein phosphatases and associated proteins [BR:gur01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Gura_2076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2432835..2433923
Genome map
AA seq 362 aa AA seqDB search
MKKRIGILTGGGDCPGLNAVIRGVVTAAIIKYDWEVVGVEDGFDGLLNSEKCRQLSLEDV
RGILPRGGTILGTTNRGNPFSYPVEKNGKIEYIDISESVIDRIKAMGIDALVVVGGDGSL
KIAMELMSKGVPIVGVPKTIDNDLMETDVTFGYNTALETATDALDKLHSTAESHHRVMIM
EVMGRYAGWIALESGIAGGADVILIPEIPFDIKKICHAIDERRKKGSRFSIIVAAEGAFP
DGGKRVVKQNADSAHSIERLGGVGEYIAGELSGCLDMDVRVTVLGHLQRGGSPSTFDRCL
GSRFGVKALELIAKNEFGRMVCLNGRSIKSVSIEKAVRKLKLVDPDGEMVKCAEELGIML
GR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtatcggcatacttaccggtggtggcgattgccctggactcaacgcggtt
atcaggggcgtggtaacggctgccatcataaaatatgattgggaggttgttggggttgaa
gacggattcgatggccttttgaacagtgaaaagtgtcgtcaactttcactggaagatgtg
cgcggcattcttccccgcggagggaccatactcggtacaacaaaccggggaaatcccttc
tcatatcctgtcgaaaaaaatggtaaaatcgaatatattgatatttccgagagcgttatt
gaccgtatcaaggctatgggtatcgatgcccttgtggttgtaggtggtgacggctcattg
aagatcgccatggaactgatgagcaagggggttcccattgtcggcgtaccgaaaactatc
gataacgatcttatggaaaccgatgtgaccttcggctataacacagccctggaaactgcc
accgatgccctcgacaagctgcattcaaccgcggaaagtcatcatcgtgtcatgataatg
gaggtgatggggagatatgccggttggatagccctggaatcgggaattgccggtggtgcc
gatgtcattcttatcccggaaatcccattcgacattaaaaaaatctgtcatgccattgat
gagagacgcaaaaaggggagccggttcagcattatagttgcagctgaaggtgctttccct
gatggaggtaaacgggtcgtaaagcagaatgccgactctgcccattccattgagcgcctg
ggaggagtcggtgagtatatcgccggggaactttcaggctgtctcgacatggacgtcagg
gtgacggtactgggtcacctgcagcgcggcggttcgccatcgactttcgatcgctgcctc
ggtagccgctttggggtcaaggcccttgaactcattgctaaaaacgaattcggcaggatg
gtctgcctgaatggacgaagcatcaaatcggtttccatagaaaaggctgtaaggaaactc
aaactggtcgatccggacggtgagatggtaaaatgcgccgaagagttggggataatgctc
ggcagataa

DBGET integrated database retrieval system