KEGG   Geobacter uraniireducens: Gura_2353Help
Entry
Gura_2353         CDS       T00521                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
gur  Geobacter uraniireducens
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Gura_2353
Enzymes [BR:gur01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Gura_2353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2723717..2724742)
Genome map
AA seq 341 aa AA seqDB search
MTPKDIPMVADRKASLPKVYGDTPSFLGTTVLDSKALVNGYDVIVAGVPWEGTVTWGTFS
GCELSPKTIRHASARYGGFLPEYELDLFDYLKIGDIGDVPVNPNDELATMKNVYETMGKV
YENHSIPFVLGGDHSFTPEIIRALSDNIDGNIGVIHFDAHLDNSRAFGGDKFPRCGPIHR
IAQIEKVRTRSIVHIGIRGPRNSSSQFAYAQSMGARIFAINEIRKRGIDDVISEAIDIAH
QDTKYVLVTICSDCIDAGFNPGGPADFNGLMPHELLPSLQRIGASGIAGLDYVEVYPNQD
PHGFSSHLASWALIYALSGMASVKKGSSDISGDGCRGFGSE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacacccaaagatattcctatggtagctgacagaaaggcttccctgccgaaggtgtac
ggggatactccctcatttctgggaacgacggtgctcgattcgaaagcgcttgtaaatggg
tatgacgtcatagttgccggtgtgccttgggaaggaacggtgacgtggggcaccttcagc
ggttgtgaactgtctccgaaaacgataaggcatgcttctgcacgatatgggggatttttg
ccggaatatgaactggatcttttcgattatctgaaaataggggacatcggggatgttccg
gtaaatccgaacgatgaactggccaccatgaaaaacgtgtatgagacgatggggaaagta
tatgaaaaccatagtattcctttcgtactgggtggcgatcattccttcacccccgagata
atcagggccttgagcgacaatatcgacgggaatatcggcgtgatccactttgacgctcac
ttagataattcaagggcttttggtggagataaattcccgcggtgcggtccgattcacagg
attgcccaaattgaaaaggtaagaaccaggagcatagtacatatagggatcagggggccg
agaaactcgtcttcacagtttgcgtatgcccaaagcatgggggcaagaatttttgccatc
aatgaaatcagaaagcgcggtatcgatgacgttatcagcgaggcgatcgacattgctcat
caggatacgaaatatgtcctcgttaccatatgcagcgattgcatagatgcgggcttcaat
ccggggggaccggccgatttcaacggcctgatgcctcacgaactgcttccttccctgcag
aggatcggagcatccggcatagcaggcctcgattatgttgaagtttatccaaatcaggac
ccccatggtttttcttcacatctggcttcatgggcgcttatttatgcactttcaggaatg
gcctcggtaaaaaaaggttcttccgacatttccggtgacggctgccgtggcttcgggagt
gaatga

DBGET integrated database retrieval system