KEGG   Geobacter uraniireducens: Gura_2353Help
Entry
Gura_2353         CDS       T00521                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
gur  Geobacter uraniireducens
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gur00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2723717..2724742)
Genome map
AA seq 341 aa AA seqDB search
MTPKDIPMVADRKASLPKVYGDTPSFLGTTVLDSKALVNGYDVIVAGVPWEGTVTWGTFS
GCELSPKTIRHASARYGGFLPEYELDLFDYLKIGDIGDVPVNPNDELATMKNVYETMGKV
YENHSIPFVLGGDHSFTPEIIRALSDNIDGNIGVIHFDAHLDNSRAFGGDKFPRCGPIHR
IAQIEKVRTRSIVHIGIRGPRNSSSQFAYAQSMGARIFAINEIRKRGIDDVISEAIDIAH
QDTKYVLVTICSDCIDAGFNPGGPADFNGLMPHELLPSLQRIGASGIAGLDYVEVYPNQD
PHGFSSHLASWALIYALSGMASVKKGSSDISGDGCRGFGSE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacacccaaagatattcctatggtagctgacagaaaggcttccctgccgaaggtgtac
ggggatactccctcatttctgggaacgacggtgctcgattcgaaagcgcttgtaaatggg
tatgacgtcatagttgccggtgtgccttgggaaggaacggtgacgtggggcaccttcagc
ggttgtgaactgtctccgaaaacgataaggcatgcttctgcacgatatgggggatttttg
ccggaatatgaactggatcttttcgattatctgaaaataggggacatcggggatgttccg
gtaaatccgaacgatgaactggccaccatgaaaaacgtgtatgagacgatggggaaagta
tatgaaaaccatagtattcctttcgtactgggtggcgatcattccttcacccccgagata
atcagggccttgagcgacaatatcgacgggaatatcggcgtgatccactttgacgctcac
ttagataattcaagggcttttggtggagataaattcccgcggtgcggtccgattcacagg
attgcccaaattgaaaaggtaagaaccaggagcatagtacatatagggatcagggggccg
agaaactcgtcttcacagtttgcgtatgcccaaagcatgggggcaagaatttttgccatc
aatgaaatcagaaagcgcggtatcgatgacgttatcagcgaggcgatcgacattgctcat
caggatacgaaatatgtcctcgttaccatatgcagcgattgcatagatgcgggcttcaat
ccggggggaccggccgatttcaacggcctgatgcctcacgaactgcttccttccctgcag
aggatcggagcatccggcatagcaggcctcgattatgttgaagtttatccaaatcaggac
ccccatggtttttcttcacatctggcttcatgggcgcttatttatgcactttcaggaatg
gcctcggtaaaaaaaggttcttccgacatttccggtgacggctgccgtggcttcgggagt
gaatga

DBGET integrated database retrieval system