KEGG   Geobacter uraniireducens: Gura_2506Help
Entry
Gura_2506         CDS       T00521                                 

Definition
acetyl-CoA carboxylase carboxyltransferase subunit alpha
Orthology
K01962  
acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2]
Organism
gur  Geobacter uraniireducens
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Carbon metabolism [PATH:gur01200]
Metabolism; Overview; Fatty acid metabolism [PATH:gur01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gur00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:gur00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:gur00061]
Metabolism; Metabolism of terpenoids and polyketides; Tetracycline biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2893730..2894686)
Genome map
AA seq 318 aa AA seqDB search
MATQYYLEFEKPLADLERKIEELQELSSDTLDLKAEIAKLEKKAEKVQEDIFSNLSRWQT
AQVARHINRPFTLDYLNLIFTEFIELHGDRNFGDDHAIVGGLARLDGVPVMVIGHQKGRD
TKEKVYRNFGMPNPEGYRKALRLMEMAERFKLPIITFVDTPGAFPGIGAEERGQAEAIAR
NLREMSRLSVPIIVVITGEGGSGGALAIAVGDRILMLEHSVYAVISPEGCAAILWSDGTK
GEQAAEALKLTAKDIKELEVSDEIVKEPLGGAHRDHQTMAKSLHEALSRNLKELQRIPAD
QLVEERYQKFRRMSRFVE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcaatattatcttgaatttgaaaagccgcttgccgacctggagcgcaagatt
gaagagttgcaagaattgtccagcgataccctggatctgaaggcggaaattgccaagctg
gaaaaaaaggctgaaaaggttcaggaagacatattttccaatctcagccgttggcagacc
gcacaggttgcgcgccatatcaatcgcccctttacccttgattacctgaaccttattttt
accgaattcatcgagttgcatggcgaccgcaattttggtgacgatcatgctatcgtcggc
ggtctggcaaggctggacggtgtacccgtgatggttatcggccaccagaagggacgtgac
accaaggagaaggtctaccgcaatttcggcatgccgaacccggaaggatatcgcaaggca
ttgcggctcatggagatggcagagcggttcaagcttcctatcatcacctttgtcgacacc
ccgggtgcttttcccggcatcggcgccgaggaacgggggcaggctgaggccatcgcccgc
aacctgcgggagatgtcgcggctgtctgtgccgattatagtcgtcattaccggcgaaggt
ggctccggcggcgcgctggccattgcggtcggggatcgcatcctgatgctcgagcattcc
gtctatgcggtcatctcgcccgaggggtgcgcggccatcctctggtccgacggtaccaag
ggggaacaggcggccgaggcgttgaaactgacggcaaaggatatcaaggagcttgaagta
agcgatgaaatcgtcaaagaacccctgggcggcgcccaccgtgatcatcagaccatggca
aagtctctccacgaagccctgagccggaacctgaaggaattgcagcggataccggcggac
cagctcgtcgaggagcgctaccagaagttccgcaggatgtcgcggtttgtggagtag

DBGET integrated database retrieval system