KEGG   Geobacter uraniireducens: Gura_2506Help
Entry
Gura_2506         CDS       T00521                                 

Definition
acetyl-CoA carboxylase carboxyltransferase subunit alpha
Orthology
K01962  
acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2]
Organism
gur  Geobacter uraniireducens
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gura_2506
   01212 Fatty acid metabolism
    Gura_2506
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Gura_2506
   00640 Propanoate metabolism
    Gura_2506
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Gura_2506
  Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    Gura_2506
Enzymes [BR:gur01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Gura_2506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2893730..2894686)
Genome map
AA seq 318 aa AA seqDB search
MATQYYLEFEKPLADLERKIEELQELSSDTLDLKAEIAKLEKKAEKVQEDIFSNLSRWQT
AQVARHINRPFTLDYLNLIFTEFIELHGDRNFGDDHAIVGGLARLDGVPVMVIGHQKGRD
TKEKVYRNFGMPNPEGYRKALRLMEMAERFKLPIITFVDTPGAFPGIGAEERGQAEAIAR
NLREMSRLSVPIIVVITGEGGSGGALAIAVGDRILMLEHSVYAVISPEGCAAILWSDGTK
GEQAAEALKLTAKDIKELEVSDEIVKEPLGGAHRDHQTMAKSLHEALSRNLKELQRIPAD
QLVEERYQKFRRMSRFVE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcaatattatcttgaatttgaaaagccgcttgccgacctggagcgcaagatt
gaagagttgcaagaattgtccagcgataccctggatctgaaggcggaaattgccaagctg
gaaaaaaaggctgaaaaggttcaggaagacatattttccaatctcagccgttggcagacc
gcacaggttgcgcgccatatcaatcgcccctttacccttgattacctgaaccttattttt
accgaattcatcgagttgcatggcgaccgcaattttggtgacgatcatgctatcgtcggc
ggtctggcaaggctggacggtgtacccgtgatggttatcggccaccagaagggacgtgac
accaaggagaaggtctaccgcaatttcggcatgccgaacccggaaggatatcgcaaggca
ttgcggctcatggagatggcagagcggttcaagcttcctatcatcacctttgtcgacacc
ccgggtgcttttcccggcatcggcgccgaggaacgggggcaggctgaggccatcgcccgc
aacctgcgggagatgtcgcggctgtctgtgccgattatagtcgtcattaccggcgaaggt
ggctccggcggcgcgctggccattgcggtcggggatcgcatcctgatgctcgagcattcc
gtctatgcggtcatctcgcccgaggggtgcgcggccatcctctggtccgacggtaccaag
ggggaacaggcggccgaggcgttgaaactgacggcaaaggatatcaaggagcttgaagta
agcgatgaaatcgtcaaagaacccctgggcggcgcccaccgtgatcatcagaccatggca
aagtctctccacgaagccctgagccggaacctgaaggaattgcagcggataccggcggac
cagctcgtcgaggagcgctaccagaagttccgcaggatgtcgcggtttgtggagtag

DBGET integrated database retrieval system