KEGG   Geobacter uraniireducens: Gura_2532Help
Entry
Gura_2532         CDS       T00521                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gur  Geobacter uraniireducens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Gura_2532
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gura_2532
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Gura_2532
Enzymes [BR:gur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Gura_2532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2920019..2921326)
Genome map
AA seq 435 aa AA seqDB search
MQEIRIDLPIEELPTKWYNALPDLPAILPEPKDPADGTPTIENNRRIRPVALNEQDNSAK
RWETIPGEVLEAYLRIGRPTPLQRAVSLERHLGTPAKIFFKREDVLPTGSFKLNSAIAQA
YYAKQDGFEALISETGAGQWGTAVCIAAQSYGLGAKIFMARVSYEQKPYRRYFMKLCGGE
VHPSPSNLTQSGKSFLLSDPQHPGSIGTGISEAIETALAHQGKYAYVSGSNLPHVLMHQT
IIGLETKKQLAMAGLKPDTLISCVGGGSNCGGLMLPFLPEKFKDPDSLQFLAAESDSVPR
LTKGVYEYGAGDASGLTPLTKSYTLGQGFVPPRIHVGGLRQHNGSPLVGLLRKEGLLDAT
ALSQEEAFQAGRLFSLCEGILPAPESCHAIKAAIDSALEAKEEGEDRVIVFCLSGNGFFD
LAGYEAILFKEGHQC
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaataaggatagatctcccaatagaagagctgcctaccaaatggtacaacgca
ctgccagacctccctgccattctacctgaaccgaaggatcccgctgacggtactcctact
atcgaaaataaccggcgcattcgtccggttgcgttgaacgagcaggacaactcagctaag
cgttgggaaacgatccccggtgaagtcctggaagcttatctgaggatcggcaggcctacc
ccgctgcagcgcgccgtttcccttgagcggcatctgggtactccggccaagatctttttc
aagcgggaagacgtgctgccgaccggtagcttcaaattgaactcggctatcgcccaggcc
tactacgcgaagcaggatggttttgaagcccttatatcggaaacgggagccggccagtgg
gggactgctgtctgcatagcggcgcagtcgtatggtctcggtgcaaagatattcatggca
agggtttcttacgaacagaaaccgtatcgtcgctattttatgaaactgtgcggtggtgag
gtccacccttctccaagcaacctcactcagtcgggaaagtcatttctgcttagcgaccct
cagcatcccggatccatcggcaccggaatcagcgaggcaatagaaacagcgctcgcgcat
caggggaaatacgcctacgtatccgggagtaacctcccccatgtcctgatgcaccaaacc
attatcggcctggaaaccaagaagcagctggcaatggccggattgaaacctgacacgcta
atttcctgcgtcggtggcggtagcaactgcggtggtttgatgctccccttcctgccggaa
aaatttaaggacccggacagccttcagttcctggcagcggagtcggactcggtgccacgt
ctcaccaaaggtgtctacgaatacggggccggggacgcctcggggctcacccccttgaca
aagtcctacacacttggccaaggcttcgtacctcccaggatacacgtaggaggcttgcgg
cagcacaacgggtcaccattggtgggactgctgcgtaaagaagggctacttgatgcaaca
gcactttcccaggaggaggcgtttcaggccgggaggctgttcagcttgtgcgaagggata
ctgccggcacccgaatcctgtcacgcaatcaaggcggccatagactcggcgctggaggcg
aaggaagagggagaagatagggtcattgttttctgtctgagcggcaatggtttctttgat
ttggccggatacgaggcaattttgttcaaggaaggtcaccaatgttaa

DBGET integrated database retrieval system