KEGG   Geobacter uraniireducens: Gura_2532Help
Entry
Gura_2532         CDS       T00521                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gur  Geobacter uraniireducens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Gura_2532
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gura_2532
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Gura_2532
Enzymes [BR:gur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Gura_2532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2920019..2921326)
Genome map
AA seq 435 aa AA seqDB search
MQEIRIDLPIEELPTKWYNALPDLPAILPEPKDPADGTPTIENNRRIRPVALNEQDNSAK
RWETIPGEVLEAYLRIGRPTPLQRAVSLERHLGTPAKIFFKREDVLPTGSFKLNSAIAQA
YYAKQDGFEALISETGAGQWGTAVCIAAQSYGLGAKIFMARVSYEQKPYRRYFMKLCGGE
VHPSPSNLTQSGKSFLLSDPQHPGSIGTGISEAIETALAHQGKYAYVSGSNLPHVLMHQT
IIGLETKKQLAMAGLKPDTLISCVGGGSNCGGLMLPFLPEKFKDPDSLQFLAAESDSVPR
LTKGVYEYGAGDASGLTPLTKSYTLGQGFVPPRIHVGGLRQHNGSPLVGLLRKEGLLDAT
ALSQEEAFQAGRLFSLCEGILPAPESCHAIKAAIDSALEAKEEGEDRVIVFCLSGNGFFD
LAGYEAILFKEGHQC
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaataaggatagatctcccaatagaagagctgcctaccaaatggtacaacgca
ctgccagacctccctgccattctacctgaaccgaaggatcccgctgacggtactcctact
atcgaaaataaccggcgcattcgtccggttgcgttgaacgagcaggacaactcagctaag
cgttgggaaacgatccccggtgaagtcctggaagcttatctgaggatcggcaggcctacc
ccgctgcagcgcgccgtttcccttgagcggcatctgggtactccggccaagatctttttc
aagcgggaagacgtgctgccgaccggtagcttcaaattgaactcggctatcgcccaggcc
tactacgcgaagcaggatggttttgaagcccttatatcggaaacgggagccggccagtgg
gggactgctgtctgcatagcggcgcagtcgtatggtctcggtgcaaagatattcatggca
agggtttcttacgaacagaaaccgtatcgtcgctattttatgaaactgtgcggtggtgag
gtccacccttctccaagcaacctcactcagtcgggaaagtcatttctgcttagcgaccct
cagcatcccggatccatcggcaccggaatcagcgaggcaatagaaacagcgctcgcgcat
caggggaaatacgcctacgtatccgggagtaacctcccccatgtcctgatgcaccaaacc
attatcggcctggaaaccaagaagcagctggcaatggccggattgaaacctgacacgcta
atttcctgcgtcggtggcggtagcaactgcggtggtttgatgctccccttcctgccggaa
aaatttaaggacccggacagccttcagttcctggcagcggagtcggactcggtgccacgt
ctcaccaaaggtgtctacgaatacggggccggggacgcctcggggctcacccccttgaca
aagtcctacacacttggccaaggcttcgtacctcccaggatacacgtaggaggcttgcgg
cagcacaacgggtcaccattggtgggactgctgcgtaaagaagggctacttgatgcaaca
gcactttcccaggaggaggcgtttcaggccgggaggctgttcagcttgtgcgaagggata
ctgccggcacccgaatcctgtcacgcaatcaaggcggccatagactcggcgctggaggcg
aaggaagagggagaagatagggtcattgttttctgtctgagcggcaatggtttctttgat
ttggccggatacgaggcaattttgttcaaggaaggtcaccaatgttaa

DBGET integrated database retrieval system