KEGG   Geobacter uraniireducens: Gura_2546Help
Entry
Gura_2546         CDS       T00521                                 

Definition
protein-disulfide isomerase-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
gur  Geobacter uraniireducens
Brite
Enzymes [BR:gur01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Gura_2546
Secretion system [BR:gur02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Gura_2546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2937710..2938417)
Genome map
AA seq 235 aa AA seqDB search
MTIISRKFCAGLLLALACTSAAFAASAALKPEEAFKQAYPQVKVDSFEPADINGIYQVVT
GQNVLYYVPEKDYVILGEIFTKDGKSITAERKGRLAAKLVESLPLEKAVKIGDGKKVVIE
FTDPDCPYCRKASEFLAKKTDVTRYVYFAPMAHPAAISKIQYILSSENKAKAYGEMMLGM
EIPKAAPAVSNEVKSLAQEHMELAKKMGVQGTPTFFISGQQVVGADLAKIDQLLK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcatcagcagaaagttttgcgcaggattgctactggccttggcttgcacctcg
gccgcttttgccgcatccgcagccttgaagcccgaagaggccttcaagcaggcctacccc
caggtaaaggtggacagtttcgaacctgcagacatcaatggcatttaccaggtggtcacg
ggtcagaatgtcctctattacgtgcctgagaaggattacgtgattttgggagagattttc
accaaggatggtaagagcatcactgcggagagaaaagggcgactggcagcgaagctcgtg
gagagcctccctctggagaaggcagtgaagatcggtgacggaaagaaggtcgtcattgaa
tttaccgatcccgactgtccttactgcagaaaagcctctgagttcttagccaagaaaacc
gacgtgacccgctatgtttattttgctcccatggcccatcccgccgcgatcagcaagatc
caatacatcctcagttcagagaacaaggcaaaggcctatggagagatgatgctcggcatg
gagattccaaaggctgcccctgccgtcagtaatgaggtgaagtcgctggcccaggagcat
atggaactggcgaaaaaaatgggtgtccagggaacgcctacgttcttcatcagcggacag
caagtggtcggagccgacctggcaaagatcgaccaactgctcaaatag

DBGET integrated database retrieval system