KEGG   Geobacter uraniireducens: Gura_2657Help
Entry
Gura_2657         CDS       T00521                                 

Definition
(RefSeq) diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gur  Geobacter uraniireducens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gura_2657
   01230 Biosynthesis of amino acids
    Gura_2657
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gura_2657
   00030 Pentose phosphate pathway
    Gura_2657
   00051 Fructose and mannose metabolism
    Gura_2657
   00052 Galactose metabolism
    Gura_2657
  Energy metabolism
   00680 Methane metabolism
    Gura_2657
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Gura_2657
Enzymes [BR:gur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Gura_2657
Protein phosphatases and associated proteins [BR:gur01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Gura_2657
Messenger RNA biogenesis [BR:gur03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Gura_2657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3083085..3084374)
Genome map
AA seq 429 aa AA seqDB search
MTDQDLDFTIERLGECRFPSPMRKGRFAGDGERIMYHSRFDDMKPYLAAGAEPPALELAG
PRERIFFDPATIACGIVTCGGLCPGINNVIRAVVLSLYHHYGVRRIYGFRYGYEGLVKRL
GHNPLDLTPEVVERIGEMGGTILASSRGPQDPAEMVDNVEELGIGILFAIGGDGTLKGAG
KIAGEAARRGRPISVIGIPKTIDNDISFIQTTFGFETAVAEAKLATYAANTEALGAKNGI
GLVKLMGRDSGFIAAYTALVDSQVNYCLVPEVPFTLPGLLRSLEERLTARGHAVIVVAEG
AGQELLAATGGRDASGNVKLGDIGTYLRDAIKEHFARSGREINLKYIDPSYIIRSQPANP
HDSALCLLLGHNAVHAGMAGRTNMVVGFWNNQFTHVPIDLATRQRKKIDPDGWLWSSVLA
STGQPRDIR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccaggatctggacttcaccatcgagcggctcggcgagtgccgctttccgtcg
cccatgcgcaaaggccggtttgccggcgacggcgagcggatcatgtaccactcccgcttc
gatgacatgaaaccgtacctcgcagcgggagcggagccgccggcgctggaactggccggg
ccgcgggaacggatcttcttcgacccggcgaccatcgcctgcggcattgtgacatgcggc
ggcctctgcccggggatcaacaacgtgatccgcgcagttgtgctgagcctctaccatcac
tacggcgttcggcgaatctacggcttccgctacggctacgaaggtctggtgaagcgcctc
ggtcacaaccccctcgatcttacccccgaggtggtggagcgcatcggcgagatggggggg
acgattctcgcctcttcccgggggccacaggatccggccgaaatggtcgacaacgtggag
gaactgggaatcggcatcctcttcgccatcggcggggacggcaccctgaagggggcaggg
aagatagccggggaggcggcccggcgggggcgtcccatcagcgtcatcggcatcccgaag
accatcgacaatgacatttccttcatccagacgactttcggttttgaaaccgccgtagcc
gaggcgaaactggctacctacgccgccaacaccgaggccctcggggcaaagaacggcatc
ggtctggtgaagctcatggggcgcgactcgggattcatcgccgcgtacacggcactggtg
gacagccaggtgaattattgcctggtccccgaggtacccttcaccctgccgggactgctc
cgaagcctggaggagcggcttacggcacgggggcacgcggtgatcgtcgtggcagagggg
gccggccaggaactcctggcagccacgggggggcgcgatgcctcgggcaatgtcaagctg
ggcgacatcgggacgtatctgcgggacgccatcaaggagcatttcgcacgcagcggacgg
gagatcaatctcaagtatatcgacccgagctacatcatccggagccagccggcaaatccc
cacgattcggccctctgtctcctgcttggtcacaacgcggtgcacgcggggatggcgggg
cggaccaacatggtggtggggttctggaacaaccagtttacccatgtgccgatcgatctt
gccacgcggcagaggaagaagatcgaccccgatgggtggctctggagcagcgtgcttgcc
tccaccggtcagccacgggacatacgctga

DBGET integrated database retrieval system