KEGG   Geobacter uraniireducens: Gura_2889Help
Entry
Gura_2889         CDS       T00521                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
gur  Geobacter uraniireducens
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Gura_2889
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Gura_2889
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Gura_2889
Enzymes [BR:gur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Gura_2889
Exosome [BR:gur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gura_2889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3350960..3352126
Genome map
AA seq 388 aa AA seqDB search
MKKAGLFSVYVASAAMVLQLAAPAASLASAAKNIIFMVPDGMGLADVTATRIYKNGLDGA
PLNFETLKYIGYQRTYSANSTITDSAPAASAWACGEKFNNGEISFHGDGRPFKPSILELA
KKQGKSTGLVATSTITHATPAAFGSHVVSRNCENEIARQFIEVTGVDLLLGGGVDKFKSV
KADKCGTKGDFIQEAQDKGYAVAYSKKELDKVVTDGSTKVLGLFNAAGLTPEYTRTPGIS
EPRLPEMAIAALNVLEKNKHGFFLMVEGSQVDWANHANNYPYQLGEMLAFDEAVKVVRDW
ISADEDRKENTLLIVVADHDTGGFAINGPQTALLKAGQTVEAGWTTGEHTGVDTLIWSDG
PGSKALARAIDNTDIYGVMVKAMAGSKE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcaggtctattttcagtttacgtggcatcggcagccatggtgctgcaactg
gccgcaccggccgcctccttggccagcgcggcaaagaacatcatcttcatggtgcctgac
ggcatggggcttgccgacgtcaccgccacacgcatttacaagaatggcctggacggcgcc
cctctgaactttgagaccctgaagtacattggctaccagcggacatactctgccaacagc
accatcaccgattccgcgccggcagcctccgcctgggcctgcggcgagaagttcaacaac
ggtgagatcagtttccacggcgacggccgtcccttcaagccgagcatcctcgaactggcc
aagaaacaggggaaatccaccggtctggtcgccacctccaccatcacccacgccaccccg
gccgccttcggttcccacgtggtctcccgcaactgtgaaaatgaaatcgcccgccagttt
atagaggtgaccggggtcgacctgctgctcggcggcggcgtcgataagttcaaatcggtc
aaggccgacaaatgtgggaccaaaggtgattttatccaggaagctcaggacaagggatat
gccgtggcttacagcaaaaaggaactggacaaggtggttactgacggcagcacaaaggtc
ctcgggctcttcaacgccgccggcctgacccctgaatacacccgcacccctggaatttcc
gaaccgcgcctgccggagatggccatagctgcgctgaatgtcctggaaaagaacaagcac
ggtttcttccttatggtggaaggctcccaggtggattgggccaaccacgccaacaactat
ccctatcaactgggtgaaatgctcgcttttgacgaggcagtaaaggtcgtcagggattgg
ataagcgccgatgaagaccggaaagaaaacaccctgctgatcgtggtggccgaccatgac
accggcggtttcgcaataaacggtccgcagacggcgcttctcaaggctggtcaaacggtg
gaggcggggtggacaaccggcgagcacaccggcgttgacacccttatctggagcgatggg
ccggggagcaaggctctggccagagccatcgacaacaccgacatctatggcgtgatggtc
aaggccatggctggctcaaaggagtag

DBGET integrated database retrieval system