KEGG   Geobacter uraniireducens: Gura_2898Help
Entry
Gura_2898         CDS       T00521                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gur  Geobacter uraniireducens
Pathway
gur00010  Glycolysis / Gluconeogenesis
gur00020  Citrate cycle (TCA cycle)
gur00620  Pyruvate metabolism
gur01100  Metabolic pathways
gur01110  Biosynthesis of secondary metabolites
gur01120  Microbial metabolism in diverse environments
gur01130  Biosynthesis of antibiotics
gur01200  Carbon metabolism
Module
gur_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gura_2898
   00020 Citrate cycle (TCA cycle)
    Gura_2898
   00620 Pyruvate metabolism
    Gura_2898
Enzymes [BR:gur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Gura_2898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding SIP NQRA
Motif
Other DBs
NCBI-ProteinID: ABQ27070
UniProt: A5G5K2
Position
complement(3361189..3362361)
Genome map
AA seq 390 aa AA seqDB search
MPYDFKLPDLGEGITEVELRRWLVKEGDRVVEHQGVLEVETDKAVVEVPSPRKGTISRIY
RGEGDIAKVGETLLTIAEEGEVPTQASTVPAKSNGIVGVLPEAEEEPEILATPMVRKLAR
ERGVDLRSIRGSGPRGSITPEDLSQAATPRQPEESFGPVERLPLRGVRRTIARNLIASQR
NTASVTCTEEADITDLWDLREREQEALEARGTHLTFLPFFIKAAQHALRDHPFLNASIDA
EAETIILKKHYHFGIAVETPDGLMVPVIRDVDKKSIIALAEEIQALGKKAHERTIALTDL
KGRTFTITNYGHFGGVFATPIINWPDVAILGCGRIVERPWVYRGAIVVRKILPLSLTFDH
RVTDGADAALFLAEIVRYLEDPALLFMESV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgccctatgatttcaaacttcccgacctcggcgaagggatcaccgaggtggaactgcgc
cggtggctggtaaaggaaggcgaccgggttgtcgagcaccagggggtgctggaggtggag
accgataaggcggtggtggaagtcccttcgccgcgtaaggggacgatcagccgcatttac
cggggtgaaggggacattgccaaggtcggcgagacattgctgaccattgccgaggaggga
gaagtgccgacgcaggcctccactgtgccggcgaaatcgaacggcatcgtcggcgttctg
ccagaggcggaggaagaacccgagattctcgccacccccatggtgcggaagctggcgcgg
gagcggggcgtcgacctgcgcagcattcggggcagcggtccgcgtggcagcatcaccccc
gaggacctgtcgcaggctgcaacgccacgacagcctgaagagagctttggtccggtcgag
cggctaccgcttcggggggtacgaaggaccattgcccgcaacctcattgcctcgcagcga
aacaccgcctccgttacctgcacggaggaggctgatattaccgatctttgggacctgcgt
gagcgggaacaagaggcgctggaggcaagggggacgcatctgaccttcctcccgtttttt
atcaaggcggcccagcatgccctcagggaccacccctttctcaacgcatccatagatgcc
gaagcagaaacgatcatcctcaagaagcattaccacttcggcattgccgtggagaccccg
gacgggctgatggtgccggtcatccgcgatgtggacaaaaagagcattatcgccctggcg
gaggagatccaggcgctcggcaagaaagcccacgaacggaccattgccctcaccgacttg
aaggggcgcaccttcaccatcaccaactacggccacttcggcggtgtctttgccaccccg
atcatcaactggccagatgtggccatcctcggctgcggccgcatcgtcgaacggccgtgg
gtctaccgcggcgcgatcgttgtcaggaagatccttcccctgtccctcaccttcgatcac
cgggtcaccgatggcgccgacgcggccctgttcctggcagagatcgtccgctatctggaa
gatccggccctgctgttcatggagagcgtttga

DBGET integrated database retrieval system