KEGG   Geobacter uraniireducens: Gura_3004Help
Entry
Gura_3004         CDS       T00521                                 

Definition
protein-disulfide isomerase-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
gur  Geobacter uraniireducens
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3472651..3473439)
Genome map
AA seq 262 aa AA seqDB search
MKSLATALLLVTIAAGSASAMSKEGCGGDCAGCHALSVKEANDLVKGLGGKVTRVKSPAM
RGVWEIDLEKEGKKAVAYLDFGKKYLIPGPIFNLTTKKPIAAGEQQTSPVKKVKSSSIPL
GNSIVMGNPKGKKRLFVFTDPDCPFCAKLHGELKKLVAMDPDVAVYVKLFPLKMHPTAYD
KSRVILQGPSAKLLDDAFAKLQLPAPGPETSAKGVDETIRLAKSLGVNSTPTLIFPDGSV
MPGAKDAVEIKTLLAGKTGKKK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtttagcgacggcccttttgcttgtgaccattgcggccggaagcgcatccgcc
atgtccaaggaggggtgcggcggagactgcgccggctgtcatgcattgtcggtgaaagaa
gccaatgatctcgtaaaagggttgggtggaaaggtgacccgggtgaaatctccggccatg
cggggagtctgggagattgatctggagaaggaggggaaaaaggcggttgcgtatctggat
tttggcaaaaagtacctgatccccgggccgattttcaacctgacgacgaaaaaacccatt
gccgcaggggagcagcagacttcaccggtgaagaaggtgaaatcatcctccataccgctg
ggcaattcgattgtcatggggaatcccaaggggaaaaagaggctctttgtctttaccgat
cctgactgcccgttctgcgccaaactgcacggggagctgaagaaactggtggcgatggac
cctgatgtggcggtgtacgtgaagctgtttccactgaaaatgcatccgacggcctacgac
aagtcgcgggtgattctgcaggggccgtcggccaagctccttgacgatgcgtttgccaag
cttcagttgccggctccagggccggaaacctccgccaagggggtggatgaaacaatcagg
cttgccaaatccttgggggtgaattctaccccgacactgatatttcccgacggtagtgtg
atgcctggggcgaaggacgccgttgagatcaagacgcttttggccggtaaaacggggaag
aagaaatag

DBGET integrated database retrieval system