KEGG   Geobacter uraniireducens: Gura_3125Help
Entry
Gura_3125         CDS       T00521                                 

Definition
(GenBank) peptidase M42 family protein
Organism
gur  Geobacter uraniireducens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3693132..3694202)
Genome map
AA seq 356 aa AA seqDB search
MRDASFEFLQKLLEAPSPSGYEQPAQRIFRAYIAPFAQVSTDVMGNVFGAIEGIGVERPR
VMLVGHSDEIGFQVKYLDDNGFLYFAAIGGVDPHITPGQRVNIHGCKGVVPGVIGKKPIH
LMETKERETVVKLDAQYIDIGAANRKEAETLVRVGDPVTFAVGLEKLHGDRVTSRGFDDK
AGSFVVAEVLRQVAALSAKLPVDLFGVSSVQEEVGLRGGTTSSYTVNPDIGICVEVDFST
DQPDVDKKHNGEVGIGKGPILPRGANINPVLFELLADTAARENIPVQFTGIPRATGTDAN
VMQISRGGVATALVKIPLRYMHTPVEVLSLADLENAVRLIVATLARITDKQTFIPS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatgcatcctttgaatttttacagaaactgctggaggctcccagtccgtcagga
tacgagcaaccggcccagcggatattccgcgcttacatcgccccctttgcccaagtcagc
accgatgtcatgggtaatgtcttcggtgccatcgagggcattggtgtggagcggccgcgg
gtcatgctggtcggtcactccgatgaaataggttttcaggtcaagtacttggacgacaac
ggctttctctatttcgccgccatcggtggggttgaccctcatattacccccggtcagcgg
gtgaatatccatggctgcaagggggttgttccgggggtgatcggcaagaagccgatccat
ctgatggagaccaaggagcgggagaccgtggtgaagctcgatgcccagtacatagatatc
ggcgctgctaacaggaaagaggcggaaacgctggtccgggtcggcgacccggtgaccttt
gccgtcggcctggaaaagcttcatggcgaccgggtcacttcccgcggtttcgacgacaag
gcggggagttttgtcgttgcggaggtgttgcggcaggtggcggcgttaagcgcaaaactg
ccggtcgatctcttcggcgtgtcatcggtgcaggaggaagtggggctgcgaggaggaaca
acgagcagctatacggtgaatcctgatatcggtatctgtgtcgaagtcgatttttccact
gaccagccggacgttgataaaaagcacaacggtgaagtggggatcggcaagggaccgatt
ctgccgcggggggcgaacataaaccctgtcctgttcgagcttcttgccgatacggcggcg
cgcgagaacataccggtgcagtttaccggcatcccaagggcgaccggcaccgatgccaac
gtcatgcagatatcccgcggcggtgttgccacggccctggtgaaaatacccctccgctac
atgcatactcctgtggaggtactttctttggccgatctggaaaacgccgtcaggctgatt
gtcgcgactctggcgcgaataacggataaacagacatttatcccgagctga

DBGET integrated database retrieval system