KEGG   Geobacter uraniireducens: Gura_3162Help
Entry
Gura_3162         CDS       T00521                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
gur  Geobacter uraniireducens
Pathway
gur00230  Purine metabolism
gur01100  Metabolic pathways
Module
gur_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Gura_3162
Enzymes [BR:gur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Gura_3162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 AAA_33 NTPase_1 MobB ATP_bind_1 AAA_30 AAA_23
Motif
Other DBs
NCBI-ProteinID: ABQ27323
UniProt: A5G6A5
Position
complement(3733205..3733813)
Genome map
AA seq 202 aa AA seqDB search
MKREGILFVISAPSGAGKTTLCKEVIDIFPNLRHSVSYTTRPARPGEVHGRDYYFVPIAE
FKRMVAAEEFAEWAEVHGNYYGTALKTLEEYRKCGIDVILDIDCQGAHQLKRRYHGAVYL
FVLPPSFQELRRRLDCRSSDAPEVIERRIEAAADEIKESRWYDYIIVNDVFSKAVEELKS
VLIAEQCKTHRVLEGVSQLFEI
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgaaggtattttattcgttatttccgctccatcaggggctggaaagaccacg
ctctgcaaggaagtcattgacattttcccgaacttgcggcattctgtcagctacactacg
cgtcctgcaaggcccggcgaggtgcatggccgggattattacttcgtacccattgccgag
tttaaacggatggtggcggccgaagaatttgccgagtgggctgaagttcatggcaattac
tacggtacggcccttaaaacactggaagaataccgcaagtgcggtatcgacgtgattctg
gatatcgattgccagggcgcgcaccagcttaagaggcgttatcatggggcggtttacctg
tttgtccttccgccgagctttcaggaattgcgacgcaggctcgattgtcgaagttccgat
gctccggaggtgatcgaacggcgtatcgaggctgcggctgatgagataaaagaatcccgc
tggtatgactacatcattgtcaacgatgttttcagcaaggccgttgaagagttgaagtcg
gtgctgattgccgagcaatgcaagacccacagggtgctggaaggcgtttcacagctgttc
gaaatttaa

DBGET integrated database retrieval system